Tropomyosin-1 Antibody (5Q2H6)

Western Blot: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of extracts of various cell lines, using Tropomyosin-1 Rabbit mAb (NBP3-16689) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3s.

Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Mouse heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of rat heart using Tropomyosin-1 Rabbit mAb (NBP3-16689) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunoprecipitation: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Analysis of 600ug extracts of Rat heart cells using 3ug Tropomyosin-1 antibody (NBP3-16689). Western blot was performed from the immunoprecipitate using Tropomyosin-1 antibody (NBP3-16689) at a dilition of 1:1000.

Immunocytochemistry/ Immunofluorescence: Tropomyosin-1 Antibody (5Q2H6) [NBP3-16689] - Immunofluorescence analysis of paraffin-embedded mouse heart using Tropomyosin-1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: Tropomyosin-1 Antibody (5Q2H6) [Tropomyosin-1] - Immunofluorescence analysis of paraffin-embedded mouse heart using Tropomyosin-1 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Mu, Rt
• Applications: WB, ICC/IF, IHC, IP
• Clone: 5Q2H6
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Tropomyosin-1 Antibody (5Q2H6) Summary

• Description: Novus Biologicals Rabbit Tropomyosin-1 Antibody (5Q2H6) (NBP3-16689) is a recombinant monoclonal antibody validated for use in IHC, WB, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 185-284 of human Tropomyosin-1 (P09493). LSEGKCAELEEELKTVTNNLKSLEAQAEKYSQKEDRYEEEIKVLSDKLKEAETRAEFAERSVTKLEKSIDDLEDELYAQKLKYKAISEELDHALNDMTSI
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TPM1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation 1:500 - 1:1000
  • Western Blot 1:500 - 1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Tropomyosin-1 Antibody (5Q2H6)

• alpha tropomyosin
• alpha-tropomyosin
• C15orf13
• cardiomyopathy, hypertrophic 3
• chromosome 15 open reading frame 13
• CMD1Y
• CMH3
• HTM-alpha
• sarcomeric tropomyosin kappa
• TMSA
• tropomyosin 1 (alpha) isoform 1
• tropomyosin 1 (alpha) isoform 2
• tropomyosin 1 (alpha) isoform 3
• tropomyosin 1 (alpha) isoform 4
• tropomyosin 1 (alpha) isoform 5
• tropomyosin 1 (alpha) isoform 6
• tropomyosin 1 (alpha) isoform 7
• tropomyosin 1 (alpha)
• tropomyosin alpha-1 chain
• tropomyosin-1

Background

Tropomyosin is a rigid rod shaped protein closely associated with actin filaments. Non-muscle forms of tropomyosin have been identified in a wide range of cell types.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPM1