TRNT1 Antibody

Images

 
Western Blot: TRNT1 Antibody [NBP1-57224] - Antibody Titration: 2.5ug/ml ELISA Titer: 1:62500 Positive Control: Human brain
Immunohistochemistry-Paraffin: TRNT1 Antibody [NBP1-57224] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRNT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRNT1 (tRNA nucleotidyl transferase, CCA-adding, 1) The peptide sequence was selected from the N terminal of TRNT1. Peptide sequence PQDIDFATTATPTQMKEMFQSAGIRMINNRGEKHGTITARLHEENFEITT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRNT1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
This is a rabbit polyclonal antibody against TRNT1 and was validated on Western Blot and immunohistochemistry-p

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRNT1 Antibody

  • CCA1
  • CCA-adding
  • CGI-47
  • EC 2.7.7.72
  • mitochondrial CCA-adding tRNA-nucleotidyltransferase
  • mt CCA-adding enzyme
  • mt tRNA adenylyltransferase
  • mt tRNA CCA-diphosphorylase
  • mt tRNA CCA-pyrophosphorylase
  • MtCCA
  • tRNA nucleotidyl transferase, CCA-adding, 1
  • tRNA-nucleotidyltransferase 1, mitochondrial

Background

TRNT1 belongs to the tRNA nucleotidyltransferase/poly(A) polymerase family. It adds and repairs the conserved 3'-CCA sequence necessary for the attachment of amino acids to the 3' terminus of tRNA molecules, using CTP and ATP as substrates.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5489
Species: Hu
Applications: WB, IHC
NBP2-13954
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NBP2-01198
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13815
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91041
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF5787
Species: Hu, Mu
Applications: WB, IHC, ICC
AF5309
Species: Hu
Applications: WB
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86692
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00000783-M05
Species: Hu, Mu
Applications: WB, ELISA
NBP2-33286
Species: Hu
Applications: IHC, IHC-P
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-31851
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP2-45889
Species: Hu
Applications: WB, IHC
NBP2-55986
Species: Hu
Applications: ICC/IF
AF3064
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-57224
Species: Hu
Applications: WB, IHC, IHC-P

Publications for TRNT1 Antibody (NBP1-57224) (0)

There are no publications for TRNT1 Antibody (NBP1-57224).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRNT1 Antibody (NBP1-57224) (0)

There are no reviews for TRNT1 Antibody (NBP1-57224). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRNT1 Antibody (NBP1-57224) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRNT1 Products

Bioinformatics Tool for TRNT1 Antibody (NBP1-57224)

Discover related pathways, diseases and genes to TRNT1 Antibody (NBP1-57224). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRNT1 Antibody (NBP1-57224)

Discover more about diseases related to TRNT1 Antibody (NBP1-57224).
 

Pathways for TRNT1 Antibody (NBP1-57224)

View related products by pathway.

Blogs on TRNT1

There are no specific blogs for TRNT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRNT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRNT1