TRIO Antibody


Western Blot: TRIO Antibody [NBP2-55883] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: TRIO Antibody [NBP2-55883] - Staining of human cell line SH-SY5Y shows localization to cytosol. Antibody staining is shown in green.
Western Blot: TRIO Antibody [NBP2-55883] - Analysis in human cell line A-431.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

TRIO Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: KDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSSGMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLV
Specificity of human TRIO antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (99%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIO Recombinant Protein Antigen (NBP2-55883PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TRIO Antibody

  • ARHGEF23
  • EC
  • FLJ42780
  • PTPRF-interacting protein
  • tgat
  • triple functional domain (PTPRF interacting)
  • triple functional domain protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: WB, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, ICC
Species: Hu, Mu, Rt
Applications: WB, IHC-P, PEP-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, Flow
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for TRIO Antibody (NBP2-55883) (0)

There are no publications for TRIO Antibody (NBP2-55883).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIO Antibody (NBP2-55883) (0)

There are no reviews for TRIO Antibody (NBP2-55883). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIO Antibody (NBP2-55883) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for TRIO Antibody (NBP2-55883)

Discover related pathways, diseases and genes to TRIO Antibody (NBP2-55883). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIO Antibody (NBP2-55883)

Discover more about diseases related to TRIO Antibody (NBP2-55883).

Pathways for TRIO Antibody (NBP2-55883)

View related products by pathway.

PTMs for TRIO Antibody (NBP2-55883)

Learn more about PTMs related to TRIO Antibody (NBP2-55883).

Research Areas for TRIO Antibody (NBP2-55883)

Find related products by research area.

Blogs on TRIO

There are no specific blogs for TRIO, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRIO Antibody and receive a gift card or discount.


Gene Symbol TRIO