TRIM50 Antibody - BSA Free

Western Blot: TRIM50 Antibody [NBP2-85996] - WB Suggested Anti-TRIM50 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:1562500. Positive Control: COLO205 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TRIM50 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM50. Peptide sequence: YEAFACPRVPLPVAGHPHRIGLYLHYEQGELTFFDADRPDDLRPLYTFQA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM50
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TRIM50 Antibody - BSA Free

• tripartite motif containing 50
• tripartite motif protein 50
• tripartite motif-containing 50A
• tripartite motif-containing protein 50

Background

The TRIM50 gene codes a E3 ubiquitin-protein ligase TRIM50 protein that exists in two isoforms: isoform alpha is 487 amino acids long at 54 kDA while isoform beta is 486 amino acids long at 54 kDA. TRIM50 is associated with Williams-Beuren syndrome and interacts with genes UBE2D1, UBE2D2, UBE2D3, UBE2D4 and UBE2E1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TRIM50