TRIM37 Antibody (2D11)

Images

 
Sandwich ELISA: TRIM37 Antibody (2D11) [H00004591-M01] - Detection limit for recombinant GST tagged TRIM37 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2D11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TRIM37 Antibody (2D11) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
TRIM37 (NP_056109, 865 a.a. ~ 964 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GHLEGLQMTDLENNSETGELQPVLPEGASAAPEEGMSSDSDIECDTENEEQEEHTSVGGFHDSFMVMTQPPDEDTHSSFPDGEQIGPEDLSFNTDENSGR
Specificity
TRIM37 - tripartite motif-containing 37
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TRIM37
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TRIM37 Antibody (2D11)

  • EC 6.3.2.-
  • KIAA0898Tripartite motif-containing protein 37
  • Mulibrey nanism protein
  • MULRING-B-box-coiled-coil protein
  • POB1E3 ubiquitin-protein ligase TRIM37
  • TEF3
  • tripartite motif containing 37
  • tripartite motif-containing 37

Background

This protein is a member of the tripartite motif (TRIM) family, whose members are involved in diverse cellular functions such as developmental patterning and oncogenesis. The TRIM motif includes zinc-binding domains, a RING finger region, a B-box motif and a coiled-coil domain. The RING finger and B-box domains chelate zinc and might be involved in protein-protein and/or protein-nucleic acid interactions. The gene mutations are associated with mulibrey (muscle-liver-brain-eye) nanism, an autosomal recessive disorder that involves several tissues of mesodermal origin.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM37 Antibody (H00004591-M01) (0)

There are no publications for TRIM37 Antibody (H00004591-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM37 Antibody (H00004591-M01) (0)

There are no reviews for TRIM37 Antibody (H00004591-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM37 Antibody (H00004591-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM37 Products

Research Areas for TRIM37 Antibody (H00004591-M01)

Find related products by research area.

Blogs on TRIM37

There are no specific blogs for TRIM37, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM37 Antibody (2D11) and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM37
Entrez
OMIM
Uniprot