TRIM23 Antibody - BSA Free

Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in glandular cells.

Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human thyroid gland shows strong granular cytoplasmic and nuclear positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIM23 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST
• Predicted Species: Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM23
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IP, WB reported in scientific literature (PMID: 25905670). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRIM23 Protein (NBP1-88846PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25905670).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TRIM23 Antibody - BSA Free

• ADP-ribosylation factor domain protein 1, 64kDa
• ADP-ribosylation factor domain-containing protein 1
• ARD1GTP-binding protein ARD-1
• ARF domain protein 1
• ARFD1
• E3 ubiquitin-protein ligase TRIM23
• EC 6.3.2.-
• RNF46RING finger protein 46
• tripartite motif containing 23
• tripartite motif protein TRIM23
• tripartite motif-containing 23
• Tripartite motif-containing protein 23

Background

TRIM23 is encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. This protein is also a member of the ADP ribosylation factor family of guanine nucleotide-binding family of proteins. Its carboxy terminus contains an ADP-ribosylation factor domain and a guanine nucleotide binding site, while the amino terminus contains a GTPase activating protein domain which acts on the guanine nucleotide binding site. The protein localizes to lysosomes and the Golgi apparatus. It plays a role in the formation of intracellular transport vesicles, their movement from one compartment to another, and phopholipase D activation. Three alternatively spliced transcript variants for this gene have been described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM23 Antibody (NBP1-88846)(1)

Publication using NBP1-88846

• Watanabe M, Takahashi H, Saeki Y et al. The E3 ubiquitin ligase TRIM23 regulates adipocyte differentiation via stabilization of the adipogenic activator PPARgamma. eLife 2015-04-23 [PMID: 25905670] (IP, WB, Human)

Bioinformatics

• Gene Symbol: TRIM23