TRIM23 Antibody

Images

 
Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human adrenal gland shows strong cytoplasmic and nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TRIM23 Antibody [NBP1-88846] - Staining of human thyroid gland shows strong granular cytoplasmic and nuclear positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LGDSGVWGLKKNFALLELLERLQNGPIGQYGAAEESIGISGESITRCDEDEAHLASVYCTVCATHLCSECSQVTHST
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (92%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TRIM23 Protein (NBP1-88846PEP)
Publications
Read Publication using
NBP1-88846 in the following applications:

  • IP
    1 publication
  • WB
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25905670).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM23 Antibody

  • ADP-ribosylation factor domain protein 1, 64kDa
  • ADP-ribosylation factor domain-containing protein 1
  • ARD1GTP-binding protein ARD-1
  • ARF domain protein 1
  • ARFD1
  • E3 ubiquitin-protein ligase TRIM23
  • EC 6.3.2.-
  • RNF46RING finger protein 46
  • tripartite motif containing 23
  • tripartite motif protein TRIM23
  • tripartite motif-containing 23
  • Tripartite motif-containing protein 23

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-19461
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-105
Species: Hu, Mu, Rt, Po, Bv, Ft, Mk, Pm, Rb, Sh, Xp, Ye
Applications: WB, ChIP, ELISA, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, TCS, KO, LA
NBP1-21387
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
24790002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-60103
Species: Hu
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NBP1-81010
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-85310
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
DDX0010P-100
Species: Hu, Ca
Applications: Flow, Func, IHC, IHC-Fr, IP
NBP2-14998
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-505
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-22513
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-78983
Species: Hu, Mu
Applications: WB (-), ICC/IF, IHC, IHC-P
NB100-1923
Species: Ce
Applications: WB, IHC, IHC-P, IP
NBP2-15299
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49156
Species: Hu
Applications: ICC/IF, IHC
NBP1-89843
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for TRIM23 Antibody (NBP1-88846)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IP, WB.


Filter By Application
IP
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TRIM23 Antibody (NBP1-88846) (0)

There are no reviews for TRIM23 Antibody (NBP1-88846). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TRIM23 Antibody (NBP1-88846) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM23 Products

Bioinformatics Tool for TRIM23 Antibody (NBP1-88846)

Discover related pathways, diseases and genes to TRIM23 Antibody (NBP1-88846). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM23 Antibody (NBP1-88846)

Discover more about diseases related to TRIM23 Antibody (NBP1-88846).
 

Pathways for TRIM23 Antibody (NBP1-88846)

View related products by pathway.

PTMs for TRIM23 Antibody (NBP1-88846)

Learn more about PTMs related to TRIM23 Antibody (NBP1-88846).
 

Research Areas for TRIM23 Antibody (NBP1-88846)

Find related products by research area.

Blogs on TRIM23

There are no specific blogs for TRIM23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM23 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM23