TRIM17 Antibody

Images

 
Western Blot: TRIM17 Antibody [NBP1-80044] - HepG2 cell lysate, concentration 1.25ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM17 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human TRIM17. Peptide sequence PKCPENGFWVVQLSKGTKYLSTFSALTPVMLMEPPSHMGIFLDFEAGEVS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM17
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against TRIM17 and was validated on Western blot.
Theoretical MW
54 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRIM17 Antibody

  • E3 ubiquitin-protein ligase TRIM17
  • EC 6.3.2.-
  • RBCCRNF16terf
  • RING finger protein 16
  • RING finger protein terf
  • TERF
  • Testis RING finger protein
  • tripartite motif containing 17
  • tripartite motif-containing 17
  • Tripartite motif-containing protein 17

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-26612
Species: Hu
Applications: IP (-), WB
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC, IHC-P, IP, CHIP-SEQ
NB100-2350
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-82787
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88301
Species: Hu
Applications: WB
NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31363
Species: Hu
Applications: WB, ICC/IF
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-66987
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF2574
Species: Hu
Applications: CyTOF-ready, ICFlow
NBP2-46214
Species: Hu
Applications: WB, IHC
NBP1-31302
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1556
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-85016
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49536
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-38536
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00055521-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TRIM17 Antibody (NBP1-80044) (0)

There are no publications for TRIM17 Antibody (NBP1-80044).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM17 Antibody (NBP1-80044) (0)

There are no reviews for TRIM17 Antibody (NBP1-80044). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRIM17 Antibody (NBP1-80044) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for TRIM17 Antibody (NBP1-80044)

Discover related pathways, diseases and genes to TRIM17 Antibody (NBP1-80044). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM17 Antibody (NBP1-80044)

Discover more about diseases related to TRIM17 Antibody (NBP1-80044).
 

Pathways for TRIM17 Antibody (NBP1-80044)

View related products by pathway.

PTMs for TRIM17 Antibody (NBP1-80044)

Learn more about PTMs related to TRIM17 Antibody (NBP1-80044).
 

Research Areas for TRIM17 Antibody (NBP1-80044)

Find related products by research area.

Blogs on TRIM17

There are no specific blogs for TRIM17, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM17 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM17
Uniprot