TRIM16 Antibody

Images

 
Western Blot: TRIM16 Antibody [NBP1-84921] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-596
Immunocytochemistry/ Immunofluorescence: TRIM16 Antibody [NBP1-84921] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: TRIM16 Antibody [NBP1-84921] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIM16 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:CDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIM16
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIM16 Protein (NBP1-84921PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIM16 Antibody

  • DKFZp434O1826
  • EBBPtripartite motif-containing 16
  • Estrogen-responsive B box protein
  • tripartite motif containing 16
  • tripartite motif-containing protein 16

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-59787
Species: Hu, Mu
Applications: WB, IB, ICC/IF, IHC, IHC-P, IP, PLA
AF4708
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-81776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16061
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NBP2-46214
Species: Hu
Applications: WB, IHC
NB100-2596
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NBP1-33405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-209
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-58922
Species: Hu
Applications: WB
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP2-17262
Species: Hu
Applications: WB, ICC/IF
NBP1-54899
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr
NBP1-84921
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TRIM16 Antibody (NBP1-84921) (0)

There are no publications for TRIM16 Antibody (NBP1-84921).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRIM16 Antibody (NBP1-84921) (0)

There are no reviews for TRIM16 Antibody (NBP1-84921). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIM16 Antibody (NBP1-84921) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIM16 Products

Bioinformatics Tool for TRIM16 Antibody (NBP1-84921)

Discover related pathways, diseases and genes to TRIM16 Antibody (NBP1-84921). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIM16 Antibody (NBP1-84921)

Discover more about diseases related to TRIM16 Antibody (NBP1-84921).
 

Pathways for TRIM16 Antibody (NBP1-84921)

View related products by pathway.

PTMs for TRIM16 Antibody (NBP1-84921)

Learn more about PTMs related to TRIM16 Antibody (NBP1-84921).

Blogs on TRIM16

There are no specific blogs for TRIM16, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIM16 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIM16