TRIM16 Antibody - BSA Free

Western Blot: TRIM16 Antibody [NBP1-84921] - Analysis in human cell line A-549.

Immunohistochemistry-Paraffin: TRIM16 Antibody [NBP1-84921] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Western Blot: TRIM16 Antibody [NBP1-84921] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRIM16 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRIM16 Antibody - BSA Free (NBP1-84921) is a polyclonal antibody validated for use in IHC and WB. Anti-TRIM16 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: CDFCLDDTRRVKAVKSCLTCMVNYCEEHLQPHQVNIKLQSHLLTEPVKDHNWRYCPAHHSPLSAFCCPDQQCICQDCCQEHSGHTIVSLDAARRDKEAELQCTQLDLERKLKLNENAISRLQANQKSVLVSVSEVKAVAEMQFGE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TRIM16
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRIM16 Protein (NBP1-84921PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRIM16 Antibody - BSA Free

• DKFZp434O1826
• EBBPtripartite motif-containing 16
• Estrogen-responsive B box protein
• tripartite motif containing 16
• tripartite motif-containing protein 16

Background

TRIM16 was identified as an estrogen and anti-estrogen regulated gene in epithelial cells stably expressing estrogen receptor. The protein encoded by this gene contains two B box domains and a coiled-coiled region that are characteristic of the B box zinc finger protein family. The proteins of this family have been reported to be involved in a variety of biological processes including cell growth, differentiation and pathogenesis. Expression of this gene was detected in most tissues. Its function, however, has not yet been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRIM16 Antibody (NBP1-84921)(1)

Publication using NBP1-84921

• Araya J, Saito N, Hosaka Y et al. Impaired TRIM16-Mediated Lysophagy in Chronic Obstructive Pulmonary Disease Pathogenesis Journal of immunology (Baltimore, Md. : 1950) 2021-06-16 [PMID: 34135057]

Bioinformatics

• Gene Symbol: TRIM16