TRIB2 Antibody

Images

 
Western Blot: TRIB2 Antibody [NBP1-83326] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: TRIB2 Antibody [NBP1-83326] - Staining of human cell line A-431 shows positivity in cytoplasm and nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: TRIB2 Antibody [NBP1-83326] - Staining of human spleen shows strong cytoplasmic positivity in cells in red pulp and white pulp.
Western Blot: TRIB2 Antibody [NBP1-83326] - Analysis in human cell line K562.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRIB2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TIARYGRSRNKTQDFEELSSIRSAEPSQSFSPNLGSPSPPETPNLSHCVSCIGKYLLLEPLEGDHVFRAVHLHSGEELVCKVFDISCYQESLAPCFCLSAHSNINQITEIILGETKAYVFFERSYGDMHSFVRTCKKLRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRIB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRIB2 Protein (NBP1-83326PEP)
Publications
Read Publication using NBP1-83326.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24832046)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRIB2 Antibody

  • C5FW
  • FLJ57420
  • GS3955
  • TRB-2
  • TRB2tribbles homolog 2
  • tribbles homolog 2 (Drosophila)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-46205
Species: Hu
Applications: WB, IHC
NB100-56398
Species: Hu
Applications: WB, ICC/IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00050840-R02
Species: Hu
NB600-1438
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IP
NBP2-06373
Species: Hu
NBP2-30684
Species: Hu
Applications: IHC, IHC-P
NB100-59840
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-15131
Species: Hu
Applications: WB
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP2-13408
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF953
Species: Hu
Applications: WB, Simple Western, IHC, IP
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P

Publications for TRIB2 Antibody (NBP1-83326)(1)

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
All Species

Reviews for TRIB2 Antibody (NBP1-83326) (0)

There are no reviews for TRIB2 Antibody (NBP1-83326). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRIB2 Antibody (NBP1-83326) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRIB2 Products

Bioinformatics Tool for TRIB2 Antibody (NBP1-83326)

Discover related pathways, diseases and genes to TRIB2 Antibody (NBP1-83326). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRIB2 Antibody (NBP1-83326)

Discover more about diseases related to TRIB2 Antibody (NBP1-83326).
 

Pathways for TRIB2 Antibody (NBP1-83326)

View related products by pathway.

PTMs for TRIB2 Antibody (NBP1-83326)

Learn more about PTMs related to TRIB2 Antibody (NBP1-83326).
 

Research Areas for TRIB2 Antibody (NBP1-83326)

Find related products by research area.

Blogs on TRIB2

There are no specific blogs for TRIB2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRIB2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRIB2