TRBP Antibody

Images

 
Western Blot: TRBP Antibody [NBP2-13411] - Analysis in human cell line HEK 293.
Immunocytochemistry/ Immunofluorescence: TRBP Antibody [NBP2-13411] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TRBP Antibody [NBP2-13411] - Staining of human placenta.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRBP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TVGDTSCTGQGPSKKAAKHKAAEVALKHLKGGSMLEPALEDSSSFSPLDS SLPEDIPVFTAAAAAT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TARBP2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. For Immunofluorescence, Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide
TRBP Protein (NBP2-13411PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (89%), Rat (88%).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRBP Antibody

  • LOQS
  • RISC-loading complex subunit TARBP2
  • TAR (HIV) RNA binding protein 2
  • TAR (HIV) RNA-binding protein 2
  • TAR (HIV) RNA-binding protein TRBP1
  • TAR (HIV-1) RNA binding protein 2
  • TAR RNA binding protein 2
  • TAR RNA-binding protein 2
  • trans-activation responsive RNA-binding protein
  • Trans-activation-responsive RNA-binding protein
  • TRBP
  • TRBP1
  • TRBP2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06520
Species: Hu, Mu
Applications: WB, IP
NBP1-88376
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-48990
Species: Hu
Applications: ICC/IF, IHC
46420002
Species: Hu
Applications: WB, ELISA
MAB1980
Species: Hu
Applications: WB, Simple Western, IP, ICC
NBP1-87127
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49535
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-03349
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-2817
Species: Hu
Applications: WB, IHC-P, PEP-ELISA
H00000904-Q01
Species: Hu
NB100-2574
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P, IP, PLA
NB120-10874
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56605
Species: Av, Bv, Sh
Applications: WB
NBP1-80896
Species: Hu
Applications: IHC, IHC-P

Publications for TRBP Antibody (NBP2-13411) (0)

There are no publications for TRBP Antibody (NBP2-13411).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRBP Antibody (NBP2-13411) (0)

There are no reviews for TRBP Antibody (NBP2-13411). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRBP Antibody (NBP2-13411) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRBP Products

Bioinformatics Tool for TRBP Antibody (NBP2-13411)

Discover related pathways, diseases and genes to TRBP Antibody (NBP2-13411). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRBP Antibody (NBP2-13411)

Discover more about diseases related to TRBP Antibody (NBP2-13411).
 

Pathways for TRBP Antibody (NBP2-13411)

View related products by pathway.

PTMs for TRBP Antibody (NBP2-13411)

Learn more about PTMs related to TRBP Antibody (NBP2-13411).

Blogs on TRBP

There are no specific blogs for TRBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TARBP2