TRAX Antibody - BSA Free

Western Blot: TRAX Antibody [NBP1-80666] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Immunohistochemistry-Paraffin: TRAX Antibody [NBP1-80666] - Staining of human testis shows strong cytoplasmic positivity in seminiferus duct cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TRAX Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TRAX Antibody - BSA Free (NBP1-80666) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TRAX Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IFQVAQELSGEDMHQFHRAITTGLQEYVEAVSFQHFIKTRSLISMDEINKQLIFTTEDNGKENKTPSSDAQDKQFGTWRLRVTPVDYL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TSNAX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TRAX Protein (NBP1-80666PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (82%), Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TRAX Antibody - BSA Free

• DISC1
• translin-associated factor Xdisrupted in schizophrenia 1
• translin-like protein
• TRAXtranslin-associated protein X

Background

Translin (TSN) is a DNA-binding protein that specifically binds to consensus sequences at breakpoint junctions of chromosomal translocations in many cases of lymphoid malignancies. TRAX (translin-associated factor X)was isolated as a protein that specifically interacted with TSN in cotransformation and in vitro interaction assays. TRAX bears a homology to Translin. Translin and TRAX have been proposed to be involved in DNA recombination, chromosomal translocation and mRNA transport and translation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TRAX Antibody (NBP1-80666)(1)

Publication using NBP1-80666

• Zhang Q, Tang Q, Purohit NM et al. Food-induced dopamine signaling in AgRP neurons promotes feeding Cell reports 2022-11-29 [PMID: 36450244] (ICC/IF)

Bioinformatics

• Gene Symbol: TSNAX
• Entrez:
  • 7257(Human)