TRAP1 Recombinant Protein Antigen

Images

 
There are currently no images for TRAP1 Protein (NBP2-47597PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TRAP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAP1.

Source: E. coli

Amino Acid Sequence: AMKKKDTEVLFCFEQFDELTLLHLREFDKKKLISVETDIVVDHYKEEKFEDRSPAAECLSEKETEELMAWMRNVLGSRVTNVKVTLRL

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TRAP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-47597.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAP1 Recombinant Protein Antigen

  • HSP 75
  • HSP75TNFR-associated protein 1
  • HSP90Lheat shock protein 75 kDa, mitochondrial
  • TNF receptor-associated protein 1
  • TRAP-1
  • tumor necrosis factor type 1 receptor associated protein
  • Tumor necrosis factor type 1 receptor-associated protein

Background

The 90 kDa heat shock protein (hsp90) family of molecular chaperones is a highly conserved family of proteins that play an important physiological role. Hsp90 is involved in numerous cellular processes but is best known for its association with signal transduction machinery. A recently cloned homolog of hsp90 is TRAP1. Like hsp90, TRAP1 is found to be associated with numerous proteins involved in diverse actions. Immunofluorescence data has shown TRAP1 to be localized in the mitochondria of mammalian cells. This observation and the fact that TRAP1 is shown to have a mitochondrial targeting presequence strongly implicates TRAP1 as a mitochondrial matrix protein. Immunofluorescence staining of TRAP1 in PC-3-M cells with this antibody produces a pattern consistent with mitochondrial staining. Immunoprecipitation of TRAP1 using this antibody fails to co-precipitate p23, Hop, or CyP40 suggesting TRAP1®s inability to associate with these co-chaperones.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-2928
Species: Hu, Mu, Pm, Rb, Rt, Sh
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC,  IHC-P, IP, WB
DCDL40
Species: Hu
Applications: ELISA
BC100-494
Species: Hu, Mu, Rb, Rt
Applications: EM, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, PEP-ELISA, PAGE, WB
NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-47801
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-06274
Species: Ce, Ch, Dr, Hu, Mu, Rt, Sh, Ze
Applications: Flow, ICC/IF, IHC-FrFl, IHC,  IHC-P, Simple Western, WB
NBP3-32238
Species: Hu, Pm
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NB120-2788
Species: Bv, Fe, Fi, Ha, Hu, Mu, Pm, Rt
Applications: B/N, Flow, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56104
Species: Ca, Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, IP, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB

Publications for TRAP1 Protein (NBP2-47597PEP) (0)

There are no publications for TRAP1 Protein (NBP2-47597PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAP1 Protein (NBP2-47597PEP) (0)

There are no reviews for TRAP1 Protein (NBP2-47597PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TRAP1 Protein (NBP2-47597PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAP1 Products

Research Areas for TRAP1 Protein (NBP2-47597PEP)

Find related products by research area.

Blogs on TRAP1

There are no specific blogs for TRAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TRAP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAP1