Recombinant Human Transglutaminase 5 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Transglutaminase 5 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 511-610 of Human TGM5 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:FKLLDPPNMGQDICFVLLALNMSSQFKDLKVNLSAQSLLHDGSPLSPFWQDTAFITLSPKEAKTYPCKISYSQYSQYLSTDKLIRISALGEEKSSPEKIL

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TGM5
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Transglutaminase 5 Protein

  • EC 2.3.2.13
  • protein-glutamine gamma-glutamyltransferase 5
  • TG(X)
  • TGase X
  • TGASE5
  • TGase-5
  • TGASEX
  • TGM6
  • TGMX
  • TGXMGC141907
  • transglutaminase 5
  • transglutaminase V
  • Transglutaminase X
  • transglutaminase-5

Background

TGM5 - transglutaminase 5

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5426
Species: Hu
Applications: WB
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P
AF4604
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF5725
Species: Hu
Applications: WB, IHC
NB100-1844
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-2727
Species: Hu, Po, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF5760
Species: Hu
Applications: WB, IHC
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP1-33610
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-87527
Species: Hu
Applications: IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-32962
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP2-49081
Species: Hu
Applications: WB, IHC
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ca, Ch, Fe, GP, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01) (0)

There are no publications for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01) (0)

There are no reviews for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Transglutaminase 5 Products

Bioinformatics Tool for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01)

Discover related pathways, diseases and genes to Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01)

Discover more about diseases related to Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01).
 

Pathways for Transglutaminase 5 Partial Recombinant Protein (H00009333-Q01)

View related products by pathway.

Blogs on Transglutaminase 5

There are no specific blogs for Transglutaminase 5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Transglutaminase 5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TGM5