Transgelin/TAGLN/SM22 alpha Antibody


Western Blot: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Analysis in human heart tissue.
Immunocytochemistry/ Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining in human smooth muscle and skeletal muscle tissues using anti-TAGLN antibody. Corresponding TAGLN more
Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human skeletal muscle shows low expression as expected.
Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human smooth muscle shows high expression.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Validated by:

Orthogonal Strategies


Order Details

Transgelin/TAGLN/SM22 alpha Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
Specificity of human Transgelin/TAGLN/SM22 alpha antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Transgelin/TAGLN/SM22 alpha Protein (NBP1-87981PEP)
Read Publication using
NBP1-87981 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25706627).

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Transgelin/TAGLN/SM22 alpha Antibody

  • DKFZp686P11128
  • Protein WS3-10
  • SM22 alpha
  • SM2222 kDa actin-binding protein
  • SMCCDKFZp686B01212
  • Smooth muscle protein 22-alpha
  • TAGLN1
  • transgelin variant 2
  • Transgelin
  • WS3-10
  • WS3-10SM22-alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Species: Hu, Mu
Applications: WB
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981) (0)

There are no reviews for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Transgelin/TAGLN/SM22 alpha Products

Bioinformatics Tool for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

Discover related pathways, diseases and genes to Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

Discover more about diseases related to Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981).

Pathways for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

View related products by pathway.

PTMs for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

Learn more about PTMs related to Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981).

Blogs on Transgelin/TAGLN/SM22 alpha

There are no specific blogs for Transgelin/TAGLN/SM22 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Transgelin/TAGLN/SM22 alpha Antibody and receive a gift card or discount.


Gene Symbol TAGLN