Transgelin/TAGLN/SM22 alpha Antibody

Images

 
Western Blot: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Analysis in human heart tissue.
Immunocytochemistry/ Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules.
Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human gall bladder shows strong cytoplasmic positivity in smooth muscle cells.
Immunocytochemistry/ Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human cell line U-251 MG shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human breast shows strong positivity in myoepithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Transgelin/TAGLN/SM22 alpha Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAGLN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Transgelin/TAGLN/SM22 alpha Protein (NBP1-87981PEP)
Publications
Read Publication using
NBP1-87981 in the following applications:

  • IHC
    1 publication

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25706627).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Transgelin/TAGLN/SM22 alpha Antibody

  • DKFZp686P11128
  • Protein WS3-10
  • SM22 alpha
  • SM2222 kDa actin-binding protein
  • SMCCDKFZp686B01212
  • Smooth muscle protein 22-alpha
  • TAGLN
  • TAGLN1
  • transgelin variant 2
  • Transgelin
  • WS3-10
  • WS3-10SM22-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP1-87814
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC-P, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
MAB4028
Species: Hu, Mu
Applications: WB
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P

Publications for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981) (0)

There are no reviews for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Transgelin/TAGLN/SM22 alpha Products

Bioinformatics Tool for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

Discover related pathways, diseases and genes to Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

Discover more about diseases related to Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981).
 

Pathways for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

View related products by pathway.

PTMs for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)

Learn more about PTMs related to Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981).

Blogs on Transgelin/TAGLN/SM22 alpha

There are no specific blogs for Transgelin/TAGLN/SM22 alpha, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Transgelin/TAGLN/SM22 alpha Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAGLN
Entrez