Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining of human cell line U-2 OS shows localization to mitochondria & microtubules.

Immunohistochemistry-Paraffin: Transgelin/TAGLN/SM22 alpha Antibody [NBP1-87981] - Staining in human smooth muscle and skeletal muscle tissues using anti-TAGLN antibody. Corresponding TAGLN RNA-seq data are presented for the same tissues.

Staining of human prostate shows strong cytoplasmic positivity in smooth muscle cells.

Staining of human skeletal muscle shows no positivity in myocytes as expected.

Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Staining of human liver shows no positivity in hepatocytes as expected.

Analysis in human heart tissue.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Transgelin/TAGLN/SM22 alpha Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Transgelin/TAGLN/SM22 alpha Antibody - BSA Free (NBP1-87981) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-Transgelin/TAGLN/SM22 alpha Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EKKYDEELEERLVEWIIVQCGPDVGRPDRGRLGFQVWLKNGVILSKLVNSLYPDGSKPVKVPENPPSMVFKQMEQV
• Predicted Species: Mouse (97%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAGLN
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: IHC reported in scientific literature (PMID: 25706627). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Transgelin/TAGLN/SM22 alpha Protein (NBP1-87981PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 25706627).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Transgelin/TAGLN/SM22 alpha Antibody - BSA Free

• DKFZp686P11128
• Protein WS3-10
• SM22 alpha
• SM2222 kDa actin-binding protein
• SMCCDKFZp686B01212
• Smooth muscle protein 22-alpha
• TAGLN
• TAGLN1
• transgelin variant 2
• Transgelin
• WS3-10
• WS3-10SM22-alpha

Background

In contrast to fast and slow skeletal muscle cells that fuse and terminally differentiate, smooth muscle cells are able to simultaneously proliferate and express lineage-restricted proteins. One of these proteins, expressed exclusively in smooth muscles, has been referred to as SM22-alpha, a 22 kDa protein with structural similarity to the vertebrate thin filament myofibrillar regulatory protein calponin and the Drosophila muscle protein mp20, neither of which play a direct role in the contractile apparatus.The protein is a transformation and shape-change sensitive actin cross-linking/geling protein found in fibroblasts and smooth muscle. Its expression is down-regulated in many cell lines, and this down-regulation may be an early and sensitive marker for the onset of transformation. A functional role of this protein is unclear.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Transgelin/TAGLN/SM22 alpha Antibody (NBP1-87981)(1)

Publication using NBP1-87981

• Claudio Isella, Andrea Terrasi, Sara Erika Bellomo et al. Stromal contribution to the colorectal cancer transcriptome. Nature Genetics 2015-02-23 [PMID: 25706627] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: TAGLN