TRAM1L1 Antibody

Images

 
Western Blot: TRAM1L1 Antibody [NBP1-60111] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAM1L1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TRAM1L1(translocation associated membrane protein 1-like 1) The peptide sequence was selected from the middle region of TRAM1L1. Peptide sequence LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAM1L1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TRAM1L1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRAM1L1 Antibody

  • MGC26568
  • translocating chain-associated membrane protein 1-like 1
  • translocation associated membrane protein 1-like 1

Background

TRAM1L1 is stimulatory or required for the translocation of secretory proteins across the ER membrane.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS1922
Species: Hu
Applications: IHC, IHC-P
AF7579
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
AF8038
Species: Hu, Mu, Rt
Applications: WB
NBP2-02690
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-33041
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-20799
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-85899
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-04676
Species: Hu, Mu, Rt, Ha, Sq
Applications: WB, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00009988-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-84186
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NBP1-45525
Species: Hu, Mu, Rt
Applications: WB

Publications for TRAM1L1 Antibody (NBP1-60111) (0)

There are no publications for TRAM1L1 Antibody (NBP1-60111).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAM1L1 Antibody (NBP1-60111) (0)

There are no reviews for TRAM1L1 Antibody (NBP1-60111). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAM1L1 Antibody (NBP1-60111) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAM1L1 Products

Bioinformatics Tool for TRAM1L1 Antibody (NBP1-60111)

Discover related pathways, diseases and genes to TRAM1L1 Antibody (NBP1-60111). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAM1L1 Antibody (NBP1-60111)

Discover more about diseases related to TRAM1L1 Antibody (NBP1-60111).
 

Pathways for TRAM1L1 Antibody (NBP1-60111)

View related products by pathway.

Blogs on TRAM1L1

There are no specific blogs for TRAM1L1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAM1L1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAM1L1
Uniprot