NUP54 Antibody - BSA Free

Immunohistochemistry-Paraffin: NUP54 Antibody [NBP1-85899] - Staining of human testis shows moderate to strong nuclear and nuclear membrane positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: NUP54 Antibody [NBP1-85899] - Staining of human placenta shows moderate to strong nuclear membrane positivity in trophoblastic cells.

Immunohistochemistry-Paraffin: NUP54 Antibody [NBP1-85899] - Staining of human skeletal muscle shows only weak nuclear positivity in striated muscle fibers.

Immunohistochemistry-Paraffin: NUP54 Antibody [NBP1-85899] - Staining of human stomach shows moderate nuclear membrane positivity in glandular cells.

Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Analysis in human cell line HepG2.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

NUP54 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit NUP54 Antibody - BSA Free (NBP1-85899) is a polyclonal antibody validated for use in IHC and WB. Anti-NUP54 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: PATTLYAHFEQANIKTQLQQLGVTLSMTRTELSPAQIKQLLQNPPAGVDPIIWEQAKVDNPDSEKLIPVPMVGFKELLRRLKVQDQMTKQHQTR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: NUP54
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  NUP54 Protein (NBP1-85899PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for NUP54 Antibody - BSA Free

• 54 kDa nucleoporin
• MGC13407
• nucleoporin 54kD
• nucleoporin 54kDa
• nucleoporin p54

Background

The nuclear envelope creates distinct nuclear and cytoplasmic compartments in eukaryotic cells. It consists of two concentric membranes perforated by nuclear pores, large protein complexes that form aqueous channels to regulate the flow of macromolecules between the nucleus and the cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. This gene encodes a member of the phe-gly (FG) repeat-containing nucleoporin subset. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for NUP54 Antibody (NBP1-85899)(2)

Publications using NBP1-85899

• Boers R, Boers J, Tan B et Al. Retrospective analysis of enhancer activity and transcriptome history Nat Biotechnol 2023-02-23 [PMID: 36823354]
• Rossi A, Coum A, Madelenat M, et al. Neural stem cells alter nucleocytoplasmic partitioning and accumulate nuclear polyadenylated transcripts during quiescence bioRxiv 2021-01-07

Bioinformatics

• Gene Symbol: NUP54