TRAF3IP3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TRAF3IP3 Antibody [NBP1-86974] - Immunofluorescent staining of human cell line A-431 shows localization to vesicles.
Immunohistochemistry-Paraffin: TRAF3IP3 Antibody [NBP1-86974] - Staining of human tonsil shows strong cytoplasmic positivity in lymphoid cells outside reaction centra.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TRAF3IP3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SDSSWKGQLNEDKLKGKLRSLENQLYTCTQKYSPWGMKKVLLEMEDQKNSYEQKAKESLQKVLEEKMNAEQQLQSTQRSLALAEQKCEEWRSQYEALKEDWRTLGTQHRELESQLHVLQSK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRAF3IP3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TRAF3IP3 Protein (NBP1-86974PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TRAF3IP3 Antibody

  • DJ434O14.3
  • FLJ44151
  • MGC117354
  • MGC163289
  • T3JAMTRAF3-interacting protein 3
  • TRAF3 interacting Jun N terminal kinase (JNK) activating modulator
  • TRAF3 interacting protein 3
  • TRAF3-interacting JNK-activating modulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56654
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-54692
Species: Hu, Mu, Rt
Applications: WB, IHC-P
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB120-6125
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
NB300-130
Species: Hu, Mu, Rt, Bv, Ce, Ch, Dr, Pl
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01438
Species: Hu
Applications: WB, IHC, IHC-P
NB100-59826
Species: Hu
Applications: WB, Simple Western, IP
NBP1-84869
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82182
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31566
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7474
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-14847
Species: Hu, Pm
Applications: IHC, IHC-P
NBP1-81052
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85342
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-77417
Species: Mu
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vivo, CyTOF-ready
H00085015-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NB100-56638
Species: Hu
Applications: WB

Publications for TRAF3IP3 Antibody (NBP1-86974) (0)

There are no publications for TRAF3IP3 Antibody (NBP1-86974).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF3IP3 Antibody (NBP1-86974) (0)

There are no reviews for TRAF3IP3 Antibody (NBP1-86974). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TRAF3IP3 Antibody (NBP1-86974) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TRAF3IP3 Products

Bioinformatics Tool for TRAF3IP3 Antibody (NBP1-86974)

Discover related pathways, diseases and genes to TRAF3IP3 Antibody (NBP1-86974). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAF3IP3 Antibody (NBP1-86974)

Discover more about diseases related to TRAF3IP3 Antibody (NBP1-86974).
 

Pathways for TRAF3IP3 Antibody (NBP1-86974)

View related products by pathway.

Blogs on TRAF3IP3

There are no specific blogs for TRAF3IP3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TRAF3IP3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF3IP3