New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Recombinant Human TRAF-3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human TRAF-3 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 298-410 of Human TRAF-3

Source: Wheat Germ (in vitro)

Amino Acid Sequence: FEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLE

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
TRAF3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
38.17 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human TRAF-3 GST (N-Term) Protein

  • CAP1
  • CAP-1CD40 receptor associated factor 1
  • CD40 associated protein 1
  • CD40 binding protein
  • CD40 receptor-associated factor 1
  • CD40-binding protein
  • CD40bp
  • CRAF1
  • CRAF1CAP1
  • LAP1
  • LAP1CD40BP
  • LMP1-associated protein 1
  • TNF receptor-associated factor 3
  • TRAF3
  • TRAF-3

Background

TRAF3 - TNF receptor-associated factor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
Applications: B/N, In vitro
NB100-56170
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, IP, WB
NB100-56178
Species: Ma, Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
DCDL40
Species: Hu
Applications: ELISA
H00009260-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, IP, KD, S-ELISA, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
H00009448-M07
Species: Bv, Hu, Pa
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF6386
Species: Hu
Applications: IP, WB
NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AF1162
Species: Hu
Applications: CyTOF-ready, Flow, IHC, Neut, WB
NBP1-87760
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP2-27419
Species: Hu, Pm
Applications: IHC, IHC-P, WB

Publications for TRAF-3 Partial Recombinant Protein (H00007187-Q01) (0)

There are no publications for TRAF-3 Partial Recombinant Protein (H00007187-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRAF-3 Partial Recombinant Protein (H00007187-Q01) (0)

There are no reviews for TRAF-3 Partial Recombinant Protein (H00007187-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRAF-3 Partial Recombinant Protein (H00007187-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TRAF-3 Products

Bioinformatics Tool for TRAF-3 Partial Recombinant Protein (H00007187-Q01)

Discover related pathways, diseases and genes to TRAF-3 Partial Recombinant Protein (H00007187-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TRAF-3 Partial Recombinant Protein (H00007187-Q01)

Discover more about diseases related to TRAF-3 Partial Recombinant Protein (H00007187-Q01).
 

Pathways for TRAF-3 Partial Recombinant Protein (H00007187-Q01)

View related products by pathway.

PTMs for TRAF-3 Partial Recombinant Protein (H00007187-Q01)

Learn more about PTMs related to TRAF-3 Partial Recombinant Protein (H00007187-Q01).
 

Research Areas for TRAF-3 Partial Recombinant Protein (H00007187-Q01)

Find related products by research area.

Blogs on TRAF-3

There are no specific blogs for TRAF-3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human TRAF-3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TRAF3