TRAF-1 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAF1. Source: E. coli
Amino Acid Sequence: TQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSI Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
TRAF1 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84920. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
33 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for TRAF-1 Recombinant Protein Antigen
Background
The TRAF (TNF receptor-associated factor) family is a group of adapter proteins (TRAFs 1-6) that link a wide variety of cell surface receptors to diverse signaling cascades leading to the activation of NF-kB and mitogen-activated protein kinases (reviewed in Chung et al, 2002). TRAFs are major signal transducers for both the TNF and IL- 1/TLR receptor superfamilies and collectively play important functions in both adaptive and innate immunity. The carboxy-terminal region of TRAFs is required for self-association and interaction with receptor cytoplasmic domains following ligand-induced oligomerization. TRAFs interact with a variety of proteins that regulate receptor-induced cell death or survival, and TRAF-mediated signaling can promote cell survival or interfere with death receptor-induced apoptosis. This antibody recognizes TRAF1; human TRAF1 is a 416 amino acid protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ICC, KO, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ICC, IHC, WB
Species: Mu
Applications: BA
Species: Hu
Applications: AgAct, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, WB
Species: Ma, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu, Mu, Rt
Applications: B/N, In vitro
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, KO, Simple Western, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Publications for TRAF-1 Protein (NBP1-84920PEP) (0)
There are no publications for TRAF-1 Protein (NBP1-84920PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TRAF-1 Protein (NBP1-84920PEP) (0)
There are no reviews for TRAF-1 Protein (NBP1-84920PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for TRAF-1 Protein (NBP1-84920PEP) (0)
Additional TRAF-1 Products
Research Areas for TRAF-1 Protein (NBP1-84920PEP)
Find related products by research area.
|
Blogs on TRAF-1