TRAF-1 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

TRAF-1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TRAF1.
  
  

  Source: E. coli

  Amino Acid Sequence: TQEKAHPEVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAGDLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSI

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: TRAF1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84920.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 33 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TRAF-1 Recombinant Protein Antigen

• EBI6
• EBI6MGC:10353
• Epstein-Bar virus-induced protein 6
• Epstein-Barr virus-induced protein 6
• TNF receptor-associated factor 1
• TRAF1
• TRAF-1

Background

The TRAF (TNF receptor-associated factor) family is a group of adapter proteins (TRAFs 1-6) that link a wide variety of cell surface receptors to diverse signaling cascades leading to the activation of NF-kB and mitogen-activated protein kinases (reviewed in Chung et al, 2002). TRAFs are major signal transducers for both the TNF and IL- 1/TLR receptor superfamilies and collectively play important functions in both adaptive and innate immunity. The carboxy-terminal region of TRAFs is required for self-association and interaction with receptor cytoplasmic domains following ligand-induced oligomerization. TRAFs interact with a variety of proteins that regulate receptor-induced cell death or survival, and TRAF-mediated signaling can promote cell survival or interfere with death receptor-induced apoptosis. This antibody recognizes TRAF1; human TRAF1 is a 416 amino acid protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: TRAF1