TRABD Antibody


Western Blot: TRABD Antibody [NBP1-70734] - HepG2 cell lysate, concentration 2.5 ug/ml.

Product Details

Reactivity HuSpecies Glossary
Applications WB

Order Details

TRABD Antibody Summary

Synthetic peptides corresponding to PP2447 The peptide sequence was selected from the N terminal of PP2447. Peptide sequence MDGEEQQPPHEANVEPVVPSEASEPVPRVLSGDPQNLSDVDAFNLLLEMK.
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 2.5 ug/ml
Application Notes
This is a rabbit polyclonal antibody against PP2447 and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Protein A purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TRABD Antibody

  • LP6054
  • TraB domain containing
  • traB domain-containing protein


The function remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
Species: Hu
Species: Hu
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu, Rt, Rb
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P

Publications for TRABD Antibody (NBP1-70734) (0)

There are no publications for TRABD Antibody (NBP1-70734).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TRABD Antibody (NBP1-70734) (0)

There are no reviews for TRABD Antibody (NBP1-70734). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TRABD Antibody (NBP1-70734) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TRABD Products

TRABD NBP1-70734

Bioinformatics Tool for TRABD Antibody (NBP1-70734)

Discover related pathways, diseases and genes to TRABD Antibody (NBP1-70734). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TRABD

There are no specific blogs for TRABD, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TRABD Antibody and receive a gift card or discount.


Gene Symbol TRABD