TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen

Images

 
There are currently no images for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen (NBP2-57253PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TR beta 1/NR1A2/Thyroid Hormone Receptor beta.

Source: E. coli

Amino Acid Sequence: MTPNSMTENGLTAWDKPKHCPDREHDWKLVGMSEACLHRKSHSERRSTLK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
THRB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57253.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen

  • avian erythroblastic leukemia viral (v-erb-a) oncogene homolog 2
  • c-erbA-2
  • c-erbA-beta
  • ERBA2MGC126109
  • ERBA-BETA
  • GRTH
  • MGC126110
  • NR1A2
  • NR1A2thyroid hormone receptor, beta (avian erythroblastic leukemia viral (v-erb-a)oncogene homolog 2)
  • Nuclear receptor subfamily 1 group A member 2
  • oncogene ERBA2
  • PRTH
  • THR1pituitary resistance to thyroid hormone
  • THRB
  • THRB1
  • THRB2
  • thyroid hormone receptor beta 1
  • thyroid hormone receptor beta
  • thyroid hormone receptor, beta (erythroblastic leukemia viral (v-erb-a)oncogene homolog 2, avian)
  • TR beta 1
  • v-ErbA2

Background

Thyroid Hormone Receptor beta is encoded by this gene is a nuclear hormone receptor for triiodothyronine. It is one of the several receptors for thyroid hormone, and has been shown to mediate the biological activities of thyroid hormone. Knockout studies in mice suggest that the different receptors, while having certain extent of redundancy, may mediate different functions of thyroid hormone. Defects in this gene are known to be a cause of generalized thyroid hormone resistance (GTHR), a syndrome characterized by goiter and high levels of circulating thyroid hormone (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP1-86919
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-22523
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-71770
Species: Hu, Mu
Applications: ELISA, ICC/IF, IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-01863
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
NB200-585
Species: Mu, Rt
Applications: CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
MAB7428
Species: Hu, Mu, Rt
Applications: CyTOF-ready, ICFlow, WB
NB300-109
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP2-34014
Species: Hu
Applications: IHC,  IHC-P
NBP1-83328
Species: Hu
Applications: IHC,  IHC-P, WB
MAB8306
Species: Hu
Applications: IHC, WB
DSHBG0B
Species: Hu
Applications: ELISA
NBP1-82756
Species: Hu
Applications: IHC,  IHC-P
NB300-541
Species: Am, Av, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
H00009572-M02
Species: Hu, Mu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-28863
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-57253PEP
Species: Hu
Applications: AC

Publications for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen (NBP2-57253PEP) (0)

There are no publications for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen (NBP2-57253PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen (NBP2-57253PEP) (0)

There are no reviews for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen (NBP2-57253PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen (NBP2-57253PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TR beta 1/NR1A2/Thyroid Hormone Receptor beta Products

Research Areas for TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen (NBP2-57253PEP)

Find related products by research area.

Blogs on TR beta 1/NR1A2/Thyroid Hormone Receptor beta

There are no specific blogs for TR beta 1/NR1A2/Thyroid Hormone Receptor beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TR beta 1/NR1A2/Thyroid Hormone Receptor beta Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol THRB