New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

TPT1/TCTP Antibody (2C4)

Images

 
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in MCF-7 (Cat # L046V1).
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in PC-12 (Cat # L012V1).
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in NIH/3T3 (Cat # L018V1).
ELISA: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Detection limit for recombinant GST tagged TPT1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
2C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TPT1/TCTP Antibody (2C4) Summary

Immunogen
TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Specificity
tumor protein, translationally-controlled 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TPT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00007178-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TPT1/TCTP Antibody (2C4)

  • FLJ27337
  • Fortilin
  • Histamine-releasing factor
  • HRF
  • p02
  • p23
  • TCTP
  • TCTPHRFfortilin
  • TPT1
  • translationally-controlled tumor protein
  • tumor protein, translationally-controlled 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-77685
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB110-61646
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
AF4210
Species: Hu
Applications: IHC, WB
H00010963-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-46157
Species: Hu
Applications: Flow, IHC, IHC-P, WB
NBP2-67817
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33736
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-47427
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-34031
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85485
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00002288-M01
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
NBP1-97503
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
H00007178-M03
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for TPT1/TCTP Antibody (H00007178-M03)(2)

Reviews for TPT1/TCTP Antibody (H00007178-M03) (0)

There are no reviews for TPT1/TCTP Antibody (H00007178-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPT1/TCTP Antibody (H00007178-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPT1/TCTP Products

Bioinformatics Tool for TPT1/TCTP Antibody (H00007178-M03)

Discover related pathways, diseases and genes to TPT1/TCTP Antibody (H00007178-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPT1/TCTP Antibody (H00007178-M03)

Discover more about diseases related to TPT1/TCTP Antibody (H00007178-M03).
 

Pathways for TPT1/TCTP Antibody (H00007178-M03)

View related products by pathway.

PTMs for TPT1/TCTP Antibody (H00007178-M03)

Learn more about PTMs related to TPT1/TCTP Antibody (H00007178-M03).
 

Research Areas for TPT1/TCTP Antibody (H00007178-M03)

Find related products by research area.

Blogs on TPT1/TCTP

There are no specific blogs for TPT1/TCTP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPT1/TCTP Antibody (2C4) and receive a gift card or discount.

Bioinformatics

Gene Symbol TPT1
Entrez
OMIM
Uniprot