New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » TPT1/TCTP » TPT1/TCTP Antibodies » TPT1/TCTP Antibody (2C4)

TPT1/TCTP Antibody (2C4)

 (2 Publications)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in MCF-7 (Cat # L046V1).
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in MCF-7 (Cat # L046V1).
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in PC-12 (Cat # L012V1).
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in Raw 264.7 (Cat # L024V1).
Western Blot: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Analysis of TPT1 expression in NIH/3T3 (Cat # L018V1).
ELISA: TPT1/TCTP Antibody (2C4) [H00007178-M03] - Detection limit for recombinant GST tagged TPT1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ELISA
Clone
2C4
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

TPT1/TCTP Antibody (2C4) Summary

Immunogen
TPT1 (AAH22436, 35 a.a. ~ 138 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVALLDYREDGVTPYMIFFKDGLEMEKC
Specificity
tumor protein, translationally-controlled 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TPT1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Western Blot
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.
Publications
Read Publications using H00007178-M03.

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TPT1/TCTP Antibody (2C4)

  • FLJ27337
  • Fortilin
  • Histamine-releasing factor
  • HRF
  • p02
  • p23
  • TCTP
  • TCTPHRFfortilin
  • TPT1
  • translationally-controlled tumor protein
  • tumor protein, translationally-controlled 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HSP90 alpha
Antibody - BSA Free
NBP1-77685
Simple Western: HSP90 alpha Antibody [NBP1-77685] - Image shows a specific band for Hsp90A in 0.5 mg/mL of HepG2 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
Immunocytochemistry/Immunofluorescence: HSP90 alpha Antibody [NBP1-77685] - HSP901a antibody was tested in MCF-7 cells with FITC (green). Nuclei and actin were counterstained with DAPI (blue) and Phalloidin (red).
Immunohistochemistry: HSP90 alpha Antibody [NBP1-77685] - Staining of human kidney carcinoma in HSP901A using DAB with hematoxylin counterstain.
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NPM1 Antibody -
BSA Free
NB110-61646
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in OCI-AML3 cells.
Immunocytochemistry/Immunofluorescence: Nucleophosmin Antibody [NB110-61646] - Nucleophosmin localization by immunofluorescence in HL-60 cells (negative control).
Western Blot: Nucleophosmin Antibody [NB110-61646] - Detection of mutant Nucleophosmin in OCI-AML3 lysates.
(2 Reviews)
(3 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
ALK/CD246 Antibody
AF4210
Western blot shows lysates of Rh30 human rhabdomyosarcoma cell line. PVDF membrane was probed with 0.5 µg/mL of Sheep Anti-Human ALK/CD246 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4210) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). Specific bands were detected for ALK/CD246 at approximately 220 and 140 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
ALK/CD246 was detected in immersion fixed paraffin-embedded sections of human brain (hypothalamus) using Sheep Anti-Human ALK/CD246 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4210) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to neuronal cell bodies. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
Species: Hu
Applications: IHC, WB
STI1 Antibody (4B6)
H00010963-M01
Immunocytochemistry/Immunofluorescence: STI1 Antibody (4B6) [H00010963-M01] - Analysis of monoclonal antibody to STIP1 on HeLa cell. Antibody concentration 10 ug/ml.
Immunohistochemistry-Paraffin: STI1 Antibody (4B6) [H00010963-M01] - Analysis of monoclonal antibody to STIP1 on formalin-fixed paraffin-embedded human testis. Antibody concentration 0.3 ug/ml.
Immunoprecipitation: STI1 Antibody (4B6) [H00010963-M01] - Analysis of STIP1 transfected lysate using anti-STIP1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with STIP1 MaxPab rabbit polyclonal antibody.
(4 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
CD30/TNFRSF8
Antibody (OTI1C6)
NBP2-46157
Flow Cytometry: CD30/TNFRSF8 Antibody (1C6) [NBP2-46157] - (Blue).(1:100)
Immunohistochemistry: CD30/TNFRSF8 Antibody (1C6) [NBP2-46157] - Analysis of Human lymphoma tissue.
Immunohistochemistry: CD30/TNFRSF8 Antibody (1C6) [NBP2-46157] - Analysis of Carcinoma of Human kidney tissue.
(1 Review)
Species: Hu
Applications: Flow, IHC, IHC-P, WB
HspA4 Antibody
(SD0861)
NBP2-67817
Flow Cytometry: HspA4 Antibody (SD0861) [NBP2-67817] - Analysis of Hela cells with HSPA4 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: HspA4 Antibody (SD0861) [NBP2-67817] - Staining HSPA4 in HepG2 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin: p21/CIP1/CDKN1A Antibody (WA-1) [NBP2-29463] - Formalin-fixed, paraffin-embedded human bladder carcinoma stained with p21 Monoclonal Antibody (WA-1).
(15 Publications)
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB

Calcium-binding-protei
NBP1-33736
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded mouse lung. Calcium binding protein P22 antibody dilution: 1:500.
Immunocytochemistry/Immunofluorescence: Calcium-binding-protein-P22 Antibody [NBP1-33736] - HepG2 cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: Calcium binding protein P22 protein stained by Calcium binding protein P22 antibody diluted at 1:500. Blue: Hoechst 33342 staining.
Immunohistochemistry-Paraffin: Calcium-binding-protein-P22 Antibody [NBP1-33736] - Paraffin-embedded SW480 xenograft, using antibody at 1:100 dilution.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
TCEAL1 Antibody
(OTI2G10)
NBP2-46085
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human Ovary tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Human pancreas tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Immunohistochemistry: TCEAL1 Antibody (2G10) [NBP2-46085] - Analysis of Carcinoma of Human thyroid tissue. (Heat-induced epitope retrieval by 1mM EDTA in 10mM Tris buffer (pH8.5) at 120C for 3 min)
Species: Hu
Applications: IHC, WB
D4S234E Antibody
(1C3)
H00027065-M01
Sandwich ELISA: D4S234E Antibody (1C3) [H00027065-M01] - Detection limit for recombinant GST tagged D4S234E is approximately 0.1ng/ml as a capture antibody.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in PC-12.
Western Blot: D4S234E Antibody (1C3) [H00027065-M01] - D4S234E monoclonal antibody (M01), clone 1C3. Analysis of D4S234E expression in rat brain.
(1 Publication)
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Hsp70 interacting
protein HIP Antibody
NBP2-47427
Immunocytochemistry/Immunofluorescence: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Immunofluorescent staining of human cell line Hep G2 shows localization to cytosol.
Immunohistochemistry-Paraffin: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Staining of human colon, kidney, ovary and testis using Anti-ST13 antibody NBP2-47427 (A) shows similar protein distribution across tissues to independent antibody NBP2-48786 (B).
Western Blot: Hsp70 interacting protein HIP Antibody [NBP2-47427] - Analysis using Anti-ST13 antibody NBP2-47427 (A) shows similar pattern to independent antibody NBP2-48865 (B).
(1 Publication)
Species: Ca, Hu
Applications: ICC/IF, IHC, IHC-P, WB
GR/NR3C1 Antibody
(BuGR2) - BSA Free
NB300-731
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - An intracellular stain was performed on Jurkat cells with GR/NR3C1 (BuGR2) antibody NB300-731PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerthrin.
Flow Cytometry: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Using the Alexa Fluor 647 direct conjugate An intracellular stain was performed on HeLa cells with GR/NR3C1 (BuGR2) antibody NB300-731AF647 (blue) and a matched isotype control NB600-986AF647 (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Immunocytochemistry/Immunofluorescence: GR/NR3C1 Antibody (BuGR2) [NB300-731] - Analysis of Glucocorticoid Receptor using Glucocorticoid Receptor Monoclonal Antibody (BuGR2) shows staining in A549 Cells. Glucocorticoid Receptor (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with an antibody recognizing Glucocorticoid Receptor at a dilution of 1:100 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
(3 Reviews)
(12 Publications)
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, WB
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p19ARF/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(1 Review)
(45 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
TPPP/p25 Antibody
NBP2-34031
Western Blot: TPPP/p25 Antibody [NBP2-34031] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: Human Cerebral cortex tissue.
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Staining of human cerebral cortex, liver, lower gastrointestinal and pancreas using Anti-TPPP antibody NBP2-34031 (A) shows similar protein distribution across tissues to independent antibody NBP1-80962 (B).
Immunohistochemistry-Paraffin: TPPP/p25 Antibody [NBP2-34031] - Analysis in human cerebral cortex and liver tissues using NBP2-34031 antibody. Corresponding TPPP RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
p23/PTGES3 Antibody
NBP1-85485
Immunocytochemistry/Immunofluorescence: p23/PTGES3 Antibody [NBP1-85485] - Immunofluorescent staining of human cell line A-431 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: p23/PTGES3 Antibody [NBP1-85485] - Staining of human colon, fallopian tube, kidney and testis using Anti-PTGES3 antibody NBP1-85485 (A) shows similar protein distribution across tissues to independent antibody NBP1-85486 (B).
Western Blot: p23/PTGES3 Antibody [NBP1-85485] - Analysis using Anti-PTGES3 antibody NBP1-85485 (A) shows similar pattern to independent antibody NBP1-85486 (B).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
FKBP52/FKBP4
Antibody (5C11)
H00002288-M01
ELISA: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Detection limit for recombinant GST tagged FKBP4 is approximately 1ng/ml as a capture antibody.
Western Blot: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - FKBP4 monoclonal antibody (M01), clone 5C11. Analysis of FKBP4 expression in NIH/3T3.
Immunohistochemistry-Paraffin: FKBP52/FKBP4 Antibody (5C11) [H00002288-M01] - Analysis of monoclonal antibody to FKBP4 on formalin-fixed paraffin-embedded human uterine cervix. Antibody concentration 0.5 ug/ml.
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, IP, WB
HOP Antibody
(DS14F5)
NBP1-97503
HOP Antibody (DS14F5)
(6 Publications)
Species: Bv, Ca, Ch, Gp, Ha, Hu, Mu, Md, Po, Pm, Rb, Rt, Sh, Xp
Applications: IHC, IHC-P, IP, WB
S100A10 Antibody
[Unconjugated]
AF2377
Western blot shows lysates of mouse lung and MEF mouse embryonic feeder cells. PVDF membrane was probed with 0.1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for S100A10 at approximately 11 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
S100A10 was detected in perfusion fixed frozen sections of mouse kidney using Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to plasma membrane in epithelial cells. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse lung tissue and MEF mouse embryonic feeder cells, loaded at 0.2 mg/mL. A specific band was detected for S100A10 at approximately 11 kDa (as indicated) using 1 µg/mL of Goat Anti-Mouse S100A10 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2377) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
(11 Publications)
Species: Mu
Applications: IHC, Simple Western, WB
Invadolysin
Antibody
NBP1-92025
Western Blot: Invadolysin Antibody [NBP1-92025] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: Invadolysin Antibody [NBP1-92025] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Invadolysin Antibody [NBP1-92025] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TPT1/TCTP Antibody
(2C4)
H00007178-M03
TPT1/TCTP Antibody (2C4)
Species: Hu, Mu, Rt
Applications: WB, ELISA

Publications for TPT1/TCTP Antibody (H00007178-M03)(2)


Reviews for TPT1/TCTP Antibody (H00007178-M03) (0)

There are no reviews for TPT1/TCTP Antibody (H00007178-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPT1/TCTP Antibody (H00007178-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPT1/TCTP Products

Bioinformatics Tool for TPT1/TCTP Antibody (H00007178-M03)

Discover related pathways, diseases and genes to TPT1/TCTP Antibody (H00007178-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPT1/TCTP Antibody (H00007178-M03)

Discover more about diseases related to TPT1/TCTP Antibody (H00007178-M03).
 

Pathways for TPT1/TCTP Antibody (H00007178-M03)

View related products by pathway.

PTMs for TPT1/TCTP Antibody (H00007178-M03)

Learn more about PTMs related to TPT1/TCTP Antibody (H00007178-M03).
 

Research Areas for TPT1/TCTP Antibody (H00007178-M03)

Find related products by research area.

Blogs on TPT1/TCTP

There are no specific blogs for TPT1/TCTP, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPT1/TCTP Antibody (2C4) and receive a gift card or discount.


Bioinformatics

Gene Symbol TPT1
Entrez
OMIM
Uniprot