TPPP3 Antibody (2P1I9)

Western Blot: TPPP3 Antibody (2P1I9) [NBP3-33391] - Western blot analysis of various lysates using TPPP3 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 60s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clone: 2P1I9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TPPP3 Antibody (2P1I9) Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-176 of human TPPP3 (NP_057048.2).
  
  Sequence:
  MAASTDMAGLEESFRKFAIHGDPKASGQEMNGKNWAKLCKDCKVADGKSVTGTDVDIVFSKVKGKSARVINYEEFKKALEELATKRFKGKSKEEAFDAICQLVAGKEPANVGVTKAKTGGAVDRLTDTSRYTGSHKERFDESGKGKGIAGRQDILDDSGYVSAYKNAGTYDAKVKK
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TPPP3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 19 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TPPP3 Antibody (2P1I9)

• brain specific protein
• CGI-38
• p20
• p25gamma
• TPPP/p20
• tubulin polymerization-promoting protein family member 3

Background

TPPP3 binds tubulin and has microtubule bundling activity. May play a role in cell proliferation and mitosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPPP3