TPD52L2/D54 Antibody

Images

 
Western Blot: TPD52L2/D54 Antibody [H00007165-B01P] - Analysis of TPD52L2 expression in transfected 293T cell line by TPD52L2 polyclonal antibody. Lane 1: TPD52L2 transfected lysate(22.77 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

TPD52L2/D54 Antibody Summary

Immunogen
TPD52L2 (AAH06804, 1 a.a. - 206 a.a.) full-length human protein. MDSAGQDINLNSPNKGLLSDSMTDVPVDTGVAARTPAVEGLTEAEEEELRAELTKVEEEIVTLRQVLAAKERHCGELKRRLGLSTLGELKQNLSRSWHDVQVSSAYVKTSEKLGEWNEKVTQSDLYKKTQETLSQAGQKTSAALSTVGSAISRKLGDMRNSATFKSFEDRVGTIKSKVVGDRENGSDNLPSSAGSGDKPLSDPAPF
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
TPD52L2
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TPD52L2/D54 Antibody

  • DKFZp686A1765
  • HCCR-binding protein 2
  • tumor protein D52-like 2hD54D54
  • tumor protein D54

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38952
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBL1-12830
Species: Hu
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP2-07799
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00030845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-33283
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87283
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58362
Species: Hu
Applications: ICC/IF
H00002181-B01P
Species: Hu
Applications: WB, ICC/IF
NBP2-27202
Species: Hu, Mu, Rt, Po, Ca, Ch, ChHa, Fe, Op, Other, Pm
Applications: WB, Simple Western

Publications for TPD52L2/D54 Antibody (H00007165-B01P) (0)

There are no publications for TPD52L2/D54 Antibody (H00007165-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52L2/D54 Antibody (H00007165-B01P) (0)

There are no reviews for TPD52L2/D54 Antibody (H00007165-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPD52L2/D54 Antibody (H00007165-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPD52L2/D54 Products

Bioinformatics Tool for TPD52L2/D54 Antibody (H00007165-B01P)

Discover related pathways, diseases and genes to TPD52L2/D54 Antibody (H00007165-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPD52L2/D54 Antibody (H00007165-B01P)

Discover more about diseases related to TPD52L2/D54 Antibody (H00007165-B01P).
 

Pathways for TPD52L2/D54 Antibody (H00007165-B01P)

View related products by pathway.

Blogs on TPD52L2/D54

There are no specific blogs for TPD52L2/D54, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPD52L2/D54 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPD52L2
Uniprot