TPD52 Antibody (1B6) - Azide and BSA Free

Western Blot: TPD52 Antibody (1B6) [H00007163-M01] - Analysis of TPD52 expression in transfected 293T cell line by TPD52 monoclonal antibody (M01), clone 1B6.Lane 1: TPD52 transfected lysate(19.863 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: TPD52 Antibody (1B6) [H00007163-M01] - Detection limit for recombinant GST tagged TPD52 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1B6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TPD52 Antibody (1B6) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TPD52 (NP_005070, 100 a.a. ~ 184 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
• Specificity: TPD52 - tumor protein D52 (1B6)
• Isotype: IgG2b Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TPD52
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TPD52 Antibody (1B6) - Azide and BSA Free

• D52
• hD52
• N8L
• PC-1
• PrLZ
• prostate and colon associated protein
• prostate leucine zipper
• Protein N8
• tumor protein D52

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TPD52
• Entrez:
  • 7163(Human)
• Uniprot:
  • NP_005070(Human)