TPD52 Antibody (1B6)


Western Blot: TPD52 Antibody (1B6) [H00007163-M01] - Analysis of TPD52 expression in transfected 293T cell line by TPD52 monoclonal antibody (M01), clone 1B6.Lane 1: TPD52 transfected lysate(19.863 KDa).Lane 2: more
Sandwich ELISA: TPD52 Antibody (1B6) [H00007163-M01] - Detection limit for recombinant GST tagged TPD52 is approximately 1ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

TPD52 Antibody (1B6) Summary

TPD52 (NP_005070, 100 a.a. - 184 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SETLSQAGQKASAAFSSVGSVITKKLEDVKNSPTFKSFEEKVENLKSKVGGTKPAGGDFGEVLNSAANASATTTEPLPEKTQESL
TPD52 - tumor protein D52 (1B6)
IgG2b Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA.
Positive Control
TPD52 Lysate (NBP2-65181)

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TPD52 Antibody (1B6)

  • D52
  • hD52
  • N8L
  • PC-1
  • PrLZ
  • prostate and colon associated protein
  • prostate leucine zipper
  • Protein N8
  • tumor protein D52


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: ICC
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA

Publications for TPD52 Antibody (H00007163-M01) (0)

There are no publications for TPD52 Antibody (H00007163-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPD52 Antibody (H00007163-M01) (0)

There are no reviews for TPD52 Antibody (H00007163-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TPD52 Antibody (H00007163-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional TPD52 Products

Bioinformatics Tool for TPD52 Antibody (H00007163-M01)

Discover related pathways, diseases and genes to TPD52 Antibody (H00007163-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPD52 Antibody (H00007163-M01)

Discover more about diseases related to TPD52 Antibody (H00007163-M01).

Pathways for TPD52 Antibody (H00007163-M01)

View related products by pathway.

PTMs for TPD52 Antibody (H00007163-M01)

Learn more about PTMs related to TPD52 Antibody (H00007163-M01).

Research Areas for TPD52 Antibody (H00007163-M01)

Find related products by research area.

Blogs on TPD52

There are no specific blogs for TPD52, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TPD52 Antibody (1B6) and receive a gift card or discount.


Gene Symbol TPD52