TPCN1 Antibody

Images

 
Immunohistochemistry-Paraffin: TPCN1 Antibody [NBP1-83642] - Staining of human kidney shows moderate cytoplasmic positivity in cells in renal tubules.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TPCN1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FKSLLLHKRTAIQHAYRLLISQRRPAGISYRQFEGLMRFYKPRMSARERYLTFKALNQNNTPLLSLKDFYDIYEVAALKWKAKKNREHWFDELPRT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TPCN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TPCN1 Protein (NBP1-83642PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TPCN1 Antibody

  • FLJ20612
  • KIAA1169
  • TPC1
  • two pore segment channel 1
  • two-pore channel 1
  • two-pore segment channel 1
  • voltage-dependent calcium channel protein TPC1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86923
Species: Hu
Applications: IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP2-33404
Species: Hu
Applications: IHC, IHC-P
NBP1-80528
Species: Hu
Applications: WB
NBP1-89942
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB110-82375
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-2756
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-240
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IP, PLA
NBP2-46403
Species: Hu
Applications: IHC
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP

Publications for TPCN1 Antibody (NBP1-83642) (0)

There are no publications for TPCN1 Antibody (NBP1-83642).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TPCN1 Antibody (NBP1-83642) (0)

There are no reviews for TPCN1 Antibody (NBP1-83642). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TPCN1 Antibody (NBP1-83642) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TPCN1 Products

Bioinformatics Tool for TPCN1 Antibody (NBP1-83642)

Discover related pathways, diseases and genes to TPCN1 Antibody (NBP1-83642). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TPCN1 Antibody (NBP1-83642)

Discover more about diseases related to TPCN1 Antibody (NBP1-83642).
 

Pathways for TPCN1 Antibody (NBP1-83642)

View related products by pathway.

PTMs for TPCN1 Antibody (NBP1-83642)

Learn more about PTMs related to TPCN1 Antibody (NBP1-83642).

Blogs on TPCN1

There are no specific blogs for TPCN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TPCN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TPCN1