Torsin-4A Antibody

Immunocytochemistry/Immunofluorescence: C9orf167 Antibody [NBP1-93983] - Staining of human cell line HaCaT shows localization to nucleoplasm.

Immunohistochemistry-Paraffin: C9orf167 Antibody [NBP1-93983] - Staining of human spleen shows moderate cytoplasmic positivity in cells in red pulp.

Immunohistochemistry-Paraffin: C9orf167 Antibody [NBP1-93983] - Staining of human stomach, upper shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: C9orf167 Antibody [NBP1-93983] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: C9orf167 Antibody [NBP1-93983] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: C9orf167 Antibody [NBP1-93983] - Staining of human lung shows moderate cytoplasmic positivity in pneumocytes and macrophages.

Product Discontinued

Torsin-4A Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SRLVLYPETSRKYRPRVEHRSRAQRCLLLLVAIVGFQVLNAIENLDDNAQRYDLDGLEKALQRAVFGQPAAVSRIVALMRD
• Predicted Species: Rat (90%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOR4A
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for Torsin-4A Antibody

• C9orf167
• chromosome 9 open reading frame 167
• FLJ20245
• RP13-122B23.4
• torsin family 4, member A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOR4A