Topoisomerase I Antibody (1A1) - Azide and BSA Free

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in JAR.

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01] - Analysis of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1~10 ug/ml.

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in HeLa.

Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in human ovarian cancer.

Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01] - Analysis of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. Antibody concentration 3 ug/ml.

ELISA: Topoisomerase I Antibody (1A1) [H00007150-M01] - Detection limit for recombinant GST tagged TOP1 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clone: 1A1
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

Topoisomerase I Antibody (1A1) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: TOP1 (NP_003277, 692 a.a. ~ 765 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
• Localization: Cytoplasmic and Nuclear.
• Specificity: TOP1 - topoisomerase (DNA) I
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: TOP1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Topoisomerase I Antibody (1A1) - Azide and BSA Free

• DNA topoisomerase 1
• DNA topoisomerase I
• EC 5.6.2.1
• EC 5.99.1.2
• TOP1
• TOPI
• topoisomerase (DNA) I
• Topoisomerase I
• type I DNA topoisomerase

Background

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for Topoisomerase I Antibody (H00007150-M01)(2)

Publications using H00007150-M01

• Kobayashi M, Aida M, Nagaoka H et al. AID-induced decrease in topoisomerase 1 induces DNA structural alteration and DNA cleavage for class switch recombination. Proc Natl Acad Sci U S A 2009-12-29 [PMID: 20018730]
• Cayli S, Klug J, Chapiro J et al. COP9 signalosome interacts ATP-dependently with p97/valosin-containing protein (VCP) and controls the ubiquitination status of proteins bound to p97/VCP. J Biol Chem 284(50):34944-53. 2009-12-11 [PMID: 19826004]

Bioinformatics

• Gene Symbol: TOP1
• Entrez:
  • 7150(Human)
• OMIM:
  • 126420(Human)
• Uniprot:
  • NP_003277(Human)