Topoisomerase I Antibody (1A1)

Images

 
Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in JAR.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01] - Analysis of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human stomach. Antibody concentration 1~10 ug/ml.
Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in HeLa.
Western Blot: Topoisomerase I Antibody (1A1) [H00007150-M01] - TOP1 monoclonal antibody (M01), clone 1A1. Analysis of TOP1 expression in human ovarian cancer.
Immunohistochemistry-Paraffin: Topoisomerase I Antibody (1A1) [H00007150-M01] - Analysis of monoclonal antibody to TOP1 on formalin-fixed paraffin-embedded human hepatocellular carcinoma. Antibody concentration 3 ug/ml.
ELISA: Topoisomerase I Antibody (1A1) [H00007150-M01] - Detection limit for recombinant GST tagged TOP1 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1A1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Topoisomerase I Antibody (1A1) Summary

Immunogen
TOP1 (NP_003277 692 a.a. - 765 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. QRLEEQLMKLEVQATDREENKQIALGTSKLNYLDPRITVAWCKKWGVPIEKIYNKTQREKFAWAIDMADEDYEF
Localization
Cytoplasmic and Nuclear.
Specificity
TOP1 - topoisomerase (DNA) I
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
TOP1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against recombinant protein for WB. It has been used for IHC-P and ELISA.
Publications
Read Publications using H00007150-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Topoisomerase I Antibody (1A1)

  • DNA topoisomerase 1
  • DNA topoisomerase I
  • EC 5.99.1.2
  • TOPI
  • topoisomerase (DNA) I
  • type I DNA topoisomerase

Background

Topoisomerases are nuclear enzymes involved in a variety of cellular activities such as chromosome condensation, DNA replication, transcription, recombination and segregation at mitosis. Human topoisomerase I is a 100kD protein capable of relaxing positively and negatively supercoiled DNA by performing a transient single stranded nick which is then religated at the end of the reaction. It has been shown that the enzyme is located in regions of the genome that are undergoing active RNA synthesis, where it probably reduces superhelical stresses in the DNA, enabling RNA polymerase to function properly. Both DNA topoisomerases I and II have been found to be targets of autoantibodies in the sera of patients with certain autoimmune diseases such as systemic lupus erythematosus and also of some anti tumor drugs and antibiotics. Elevated levels of DNA topoisomerase I, detected by transfer assays, have been demonstrated in colorectal tumors compared with normal colon mucosa as a result of increased transcription or mRNA stability.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84975
Species: Hu
Applications: IHC, IHC-P
NBP2-06672
Species: Hu
NB100-81642
Species: Hu
Applications: WB, IHC, IHC-P, IP, PLA
NBP1-86928
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-384
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-104
Species: Hu, Mu
Applications: WB, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP
NBP2-22124
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-27335
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56546
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-88899
Species: Hu
Applications: IHC, IHC-P
NBP2-67219
Species: Hu, Mu
Applications: ICC/IF, IHC
NB100-93325
Species: Hu
Applications: WB, IP
NB100-80870
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, ELISA, IHC, IHC-P
NBP2-58116
Species: Hu
Applications: ICC/IF
NB100-142
Species: Hu, Mu, Rt, Ch, Ha
Applications: WB, Simple Western, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-42349
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for Topoisomerase I Antibody (H00007150-M01)(2)

Reviews for Topoisomerase I Antibody (H00007150-M01) (0)

There are no reviews for Topoisomerase I Antibody (H00007150-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Topoisomerase I Antibody (H00007150-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Topoisomerase I Products

Bioinformatics Tool for Topoisomerase I Antibody (H00007150-M01)

Discover related pathways, diseases and genes to Topoisomerase I Antibody (H00007150-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Topoisomerase I Antibody (H00007150-M01)

Discover more about diseases related to Topoisomerase I Antibody (H00007150-M01).
 

Pathways for Topoisomerase I Antibody (H00007150-M01)

View related products by pathway.

PTMs for Topoisomerase I Antibody (H00007150-M01)

Learn more about PTMs related to Topoisomerase I Antibody (H00007150-M01).
 

Research Areas for Topoisomerase I Antibody (H00007150-M01)

Find related products by research area.

Blogs on Topoisomerase I

There are no specific blogs for Topoisomerase I, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Topoisomerase I Antibody (1A1) and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP1
Entrez
OMIM
Uniprot