TopBP1 Recombinant Protein Antigen

Images

 
There are currently no images for TopBP1 Recombinant Protein Antigen (NBP2-55483PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TopBP1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TopBP1.

Source: E. coli

Amino Acid Sequence: KYEAAKKWNLPAVTIAWLLETARTGKRADESHFLIENSTKEERSLETEITNGINLNSDTAEHPGTRLQTHRKTVVTPLDMNRFQSKAFRAVVS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOPBP1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55483. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TopBP1 Recombinant Protein Antigen

  • DNA topoisomerase II-beta-binding protein 1
  • DNA topoisomerase II-binding protein 1
  • KIAA0259DNA topoisomerase 2-binding protein 1
  • TOP2BP1
  • TopBP1
  • topoisomerase (DNA) II binding protein 1

Background

DNA topoisomerase II-binding protein 1 (TopBP1) is a protein that interacts with the C-terminal region of topoisomerase II beta (Topo II beta). TopBP1 function has been found to be important to various aspects of cellular growth control such as DNA replication, the DNA damage checkpoint, and cell survival. TopBP1 interacts with several proteins through its BRCA1 C-terminal (BRCT) motifs. TopBP1 interacts and inhibits E2F1 transcriptional activity through an Rb-independent mechanism that involves recruitment of the SWI/SNF chromatin-remodeling complex proteins Brg1 and Brm.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-308
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
NB100-464
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP2-03417
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
NB100-56585
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-404
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB100-309
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC,  IHC-P, IP, KD, PAGE, Single-Cell Western, WB
NBP2-02004
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB120-13600
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-71688
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC,  IHC-P, IP, ISH, KD, KO, PAGE, WB
NBP2-13266
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
H00005810-M01J
Species: Hu
Applications: ELISA, IHC,  IHC-P, KD, ELISA(Cap), S-ELISA, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
NBP1-89445
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-31883
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PLA, Simple Western, WB
NB100-247
Species: Hu
Applications: IHC,  IHC-P, IP, WB

Publications for TopBP1 Recombinant Protein Antigen (NBP2-55483PEP) (0)

There are no publications for TopBP1 Recombinant Protein Antigen (NBP2-55483PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TopBP1 Recombinant Protein Antigen (NBP2-55483PEP) (0)

There are no reviews for TopBP1 Recombinant Protein Antigen (NBP2-55483PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TopBP1 Recombinant Protein Antigen (NBP2-55483PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TopBP1 Products

Blogs on TopBP1

There are no specific blogs for TopBP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TopBP1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOPBP1