TopBP1 Antibody (6D12) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse TopBP1 Antibody (6D12) - Azide and BSA Free (H00011073-M04-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
TOPBP1 (NP_008958, 1327 a.a. ~ 1435 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LLQSGGAKVLPGHSVPLFKEATHLFSDLNKLKPDDSGVNIAEAAAQNVYCLRTEYIADYLMQESPPHVENYCLPEAISFIQNNKELGTGLSQKRKAPTEKNKIKRPRVH |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
TOPBP1 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for TopBP1 Antibody (6D12) - Azide and BSA Free
Background
DNA topoisomerase II-binding protein 1 (TopBP1) is a protein that interacts with the C-terminal region of topoisomerase II beta (Topo II beta). TopBP1 function has been found to be important to various aspects of cellular growth control such as DNA replication, the DNA damage checkpoint, and cell survival. TopBP1 interacts with several proteins through its BRCA1 C-terminal (BRCT) motifs. TopBP1 interacts and inhibits E2F1 transcriptional activity through an Rb-independent mechanism that involves recruitment of the SWI/SNF chromatin-remodeling complex proteins Brg1 and Brm.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, KD, KO, WB
Species: Hu, Pm, Mu, Rt
Applications: ChIP, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, KD, PAGE, Single-Cell Western, WB
Species: Ca, Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KD, KO, PAGE, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ELISA, IHC, IHC-P, KD, ELISA(Cap), S-ELISA, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, PLA, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Publications for TopBP1 Antibody (H00011073-M04-100ug) (0)
There are no publications for TopBP1 Antibody (H00011073-M04-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TopBP1 Antibody (H00011073-M04-100ug) (0)
There are no reviews for TopBP1 Antibody (H00011073-M04-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TopBP1 Antibody (H00011073-M04-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TopBP1 Products
Array H00011073-M04-100ug
Blogs on TopBP1