TOP2A Recombinant Protein Antigen

Images

 
There are currently no images for TOP2A Recombinant Protein Antigen (NBP1-86928PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TOP2A Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TOP2A.

Source: E. coli

Amino Acid Sequence: DASPPKTKTSPKLSNKELKPQKSVVSDLEADDVKGSVPLSSSPPATHFPDETEITNPVPKKNVTVKKTAAKSQSSTSTTGAKKRAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDSNFEKIVSKAVTSKKSKG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TOP2A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86928.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TOP2A Recombinant Protein Antigen

  • DNA topoisomerase (ATP-hydrolyzing)
  • DNA topoisomerase 2-alpha
  • DNA topoisomerase II, 170 kD
  • DNA topoisomerase II, alpha isozyme
  • EC 5.99.1.3
  • TOP2
  • TOP2A
  • TOP2DNA gyrase
  • topoisomerase (DNA) II alpha (170kD)
  • topoisomerase (DNA) II alpha 170kDa
  • TP2A

Background

Topo II Alpha encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DY394
Species: Hu
Applications: ELISA
NBP1-77222
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
1129-ER
Species: Hu
Applications: BA
AF1640
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF4309
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-84037
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP2-67232
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-45570
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, WB
AF6457
Species: Hu
Applications: WB
NBP2-45946
Species: Ca, Hu, Pm, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-148
Species: Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, In vitro, KD, PLA, WB
AF231
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-90365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, PLA, WB
NBP1-89527
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-38877
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-77397
Species: Hu, Mu
Applications: Flow, IB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP1-86928PEP
Species: Hu
Applications: AC

Publications for TOP2A Recombinant Protein Antigen (NBP1-86928PEP) (0)

There are no publications for TOP2A Recombinant Protein Antigen (NBP1-86928PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOP2A Recombinant Protein Antigen (NBP1-86928PEP) (0)

There are no reviews for TOP2A Recombinant Protein Antigen (NBP1-86928PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TOP2A Recombinant Protein Antigen (NBP1-86928PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TOP2A Products

Research Areas for TOP2A Recombinant Protein Antigen (NBP1-86928PEP)

Find related products by research area.

Blogs on TOP2A

There are no specific blogs for TOP2A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TOP2A Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TOP2A