TOMM6 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TOMM6 Antibody [NBP1-90688] - Staining of human cell line A-431 shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TOMM6 Antibody [NBP1-90688] - Staining of human cervix, uterine shows cytoplasmic positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOMM6 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MASSTVPVSAAGSANETPEIPDNVGDWLRGVYRFATDRNDFRRNLILNLGLFAAGVWLARNLSDIDLMAPQ
Specificity
Specificity of human TOMM6 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOMM6
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOMM6 Protein (NBP1-90688PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOMM6 Antibody

  • FLJ32622
  • mitochondrial import receptor subunit TOM6 homolog
  • over-expressed breast tumor protein
  • TOM6
  • translocase of outer membrane 6 kDa subunit homolog
  • translocase of outer mitochondrial membrane 6 homolog (yeast)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-38289
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBL1-17193
Species: Hu
NBP1-92298
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00056993-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi, S-ELISA
NBP1-81556
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-80681
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP3-04865
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3145
Species: Hu
Applications: WB
NBP2-44318
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-81939
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-86941
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP1-77397
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IB, ICC/IF, IHC, IHC-P, KD
H00001719-M01
Species: Hu, Mu, Rt, Ye
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-84509
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-93729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-41176
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-86182
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-695
Species: Hu, Mu, Rt, Bv, Fi
Applications: WB, ELISA, IHC, KD

Publications for TOMM6 Antibody (NBP1-90688) (0)

There are no publications for TOMM6 Antibody (NBP1-90688).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOMM6 Antibody (NBP1-90688) (0)

There are no reviews for TOMM6 Antibody (NBP1-90688). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TOMM6 Antibody (NBP1-90688) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TOMM6 Products

Bioinformatics Tool for TOMM6 Antibody (NBP1-90688)

Discover related pathways, diseases and genes to TOMM6 Antibody (NBP1-90688). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOMM6 Antibody (NBP1-90688)

Discover more about diseases related to TOMM6 Antibody (NBP1-90688).
 

Pathways for TOMM6 Antibody (NBP1-90688)

View related products by pathway.

Blogs on TOMM6

There are no specific blogs for TOMM6, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOMM6 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOMM6