| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TOMM40 Antibody - BSA Free (NBP2-94075) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. Anti-TOMM40 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-90 of human TOMM40 (NP_001122389.1). MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOMM40 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Theoretical MW | 38 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
|
| Publications |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.09% Sodium Azide |
| Purity | Affinity purified |
| Publications using NBP2-94075 | Applications | Species |
|---|---|---|
| Arjona SP, Allen CNS, Santerre M et al. Disruption of Mitochondrial-associated ER membranes by HIV-1 tat protein contributes to premature brain aging CNS neuroscience & therapeutics 2022-11-23 [PMID: 36419337] (WB) | WB | |
| Arjona SP, Allen CNS, Santerre M et al. Disruption of Mitochondrial-associated ER membranes by HIV-1 tat protein contributes to premature brain aging CNS neuroscience & therapeutics 2022-11-23 [PMID: 36419337] (WB) | WB | |
| Arjona S HIV-1 Tat Affects Interorganelle Communication in HIV-Associated Neurocognitive Disorders (HAND) Thesis Jan 1 2022 (WB, Human) | WB | Human |
| Arjona SP, Allen CNS, Santerre M et al. Disruption of Mitochondrial-associated ER membranes by HIV-1 tat protein contributes to premature brain aging CNS neuroscience & therapeutics 2022 Nov 23 [PMID: 36419337] (WB) | WB |
Secondary Antibodies |
Isotype Controls |
Research Areas for TOMM40 Antibody (NBP2-94075)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TOMM40 |