![Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of various lysates using [KO Validated] TOMM20 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp2-95208_rabbit-polyclonal-tomm20-antibody-5220251636376.jpg "Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of various lysates using [KO Validated] TOMM20 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC, IP |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TOMM20 Antibody - BSA Free (NBP2-95208) is a polyclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-145 of human TOMM20 (NP_055580.1). MVGRNSAIAAGVCGALFIGYCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TOMM20 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 16 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for TOMM20 Antibody (NBP2-95208)Find related products by research area.
|
|
Parkin - Role in Mitochondrial Quality Control and Parkinson's Disease Parkin/PARK2 is a cytosolic enzyme which gets recruited to cellular mitochondria damaged through depolarization, ROS or unfolded proteins accumulation, and exert protective effects by inducing mitophagy (mitochondrial autophagy). Parkin induces mit... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TOMM20 |
![Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of lysates from wild type (WT) and TOMM20 knockout (KO) 293T cells, using [KO Validated] TOMM20 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp2-95208_rabbit-polyclonal-tomm20-antibody-52202516334157.jpg "Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of lysates from wild type (WT) and TOMM20 knockout (KO) 293T cells, using [KO Validated] TOMM20 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.")
![Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of various lysates using [KD Validated] TOMM20 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp2-95208_rabbit-polyclonal-tomm20-antibody-52202516334178.jpg "Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of various lysates using [KD Validated] TOMM20 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.")
![Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of various lysates using [KO Validated] TOMM20 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.](http://images.novusbio.com/fullsize/nbp2-95208_rabbit-polyclonal-tomm20-antibody-5220251628073.jpg "Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of various lysates using [KO Validated] TOMM20 Rabbit pAb at 1:3000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 1s.")
![Immunoprecipitation: TOMM20 Antibody - Azide and BSA Free [TOMM20] -Analysis of 200 μg extracts of HeLa cells using 3 μg TOM20 antibody. Western blot was performed from the immunoprecipitate using TOM20 antibody at a dilution of 1:1000.](http://images.novusbio.com/fullsize/nbp2-95208_rabbit-polyclonal-tomm20-antibody-immunoprecipitation-2022025111724..png "Immunoprecipitation: TOMM20 Antibody - Azide and BSA Free [TOMM20] -Analysis of 200 μg extracts of HeLa cells using 3 μg TOM20 antibody. Western blot was performed from the immunoprecipitate using TOM20 antibody at a dilution of 1:1000.")
![C1qTNF1/CTRP1 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "C1qTNF1/CTRP1 Antibody [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")