TOMM20 Antibody - Azide and BSA Free

Western Blot: TOMM20 Antibody [NBP2-94821] - Western blot analysis of extracts of various cell lines, using TOMM20 antibody (NBP2-94821) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 5min.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP2-94821] - Rat kidney using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP2-94821] - Human colon carcinoma using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: TOMM20 Antibody [NBP2-94821] - Mouse heart using [KO Validated] TOM20 Rabbit pAb at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunofluorescence analysis of U2OS cells using TOMM20 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunohistochemistry: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using TOMM20 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Rat brain using TOMM20 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Rat kidney using TOMM20 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunofluorescence analysis of HeLa cells using TOMM20 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunohistochemistry: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Mouse spleen using TOMM20 Rabbit pAb at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Western Blot: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Western blot analysis of various lysates using TOMM20 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 3s.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunofluorescence analysis of NIH/3T3 cells using TOMM20 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunofluorescence analysis of C6 cells using TOMM20 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody - Azide and BSA Free [TOMM20] - Immunofluorescence analysis of NIH/3T3 using TOMM20 Rabbit pAb at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, KO
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TOMM20 Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Knockout (KO) Validated Rabbit TOMM20 Antibody - Azide and BSA Free (NBP2-94821) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOMM20 (NP_055580.1). YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOMM20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Knockout Validated
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TOMM20 Antibody - Azide and BSA Free

• KIAA0016Outer mitochondrial membrane receptor Tom20
• MAS20
• MGC117367
• mitochondrial 20 kDa outer membrane protein
• mitochondrial import receptor subunit TOM20 homolo
• mitochondrial import receptor subunit TOM20 homolog
• MOM19
• outer mitochondrial membrane receptor Tom20
• TOM20
• TOMM20
• translocase of outer mitochondrial membrane 20 hom
• translocase of outer mitochondrial membrane 20 homolog (yeast)
• translocase of outer mitochondrial membrane 20 homolog type II

Background

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TOMM20