TOMM20 Antibody (10G6I8)

Western Blot: TOMM20 Antibody (6E0N2) [NBP3-15750] - Western blot analysis of extracts of various cell lines, using TOMM20 antibody (NBP3-15750) at 1:5000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunoprecipitation: TOMM20 Antibody (6E0N2) [NBP3-15750] - Immunoprecipitation analysis of 200ug extracts of HeLa cells using 3ug TOMM20 antibody (NBP3-15750). Western blot was performed from the immunoprecipitate using TOMM20 antibody (NBP3-15750) at a dilition of 1:1000.

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Mouse lung tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Human liver cancer tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of lysates from HeLa cells using TOMM20 Rabbit mAb at 1:10000-1:640000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of paraffin-embedded Human squamous cell lung carcinoma tissue using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IF staining. Objective: 40x.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of paraffin-embedded Mouse kidney using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . DAPI was used for nuclear staining (Blue). Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of various lysates using TOMM20 Rabbit mAb at 1:5000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - Confocal imaging of HeLa cells using TOMM20 Rabbit mAb followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) . The cells were counterstained with alpha-Tubulin Mouse mAb followed by incubation with ABflo 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: TOMM20 Antibody (10G6I8) [TOMM20] - The STORM super-resolution (SR) imaging of COS7 cells using TOMM20 Rabbit mAb at dilution of 1:200 with 3% paraformaldehyde (PFA) +0.1% glutaraldehyde (GA) fixation. The immunostaining was performed by Full Automatic Immunofluorescence Workflow System (Workflow Ultra300, Nano-Micro imaging, China). Image was performed with Single-Molecule Localization Super-Resolution Microscopy (STORM Ultra300, Nano-Micro imaging, China). We acknowledge Nano-Micro imaging Biotechnology Co., Ltd. in SR image processing and kindly providing this image.

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of various lysates using TOMM20 Rabbit mAb at 1:20000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.

Western Blot: TOMM20 Antibody (10G6I8) [TOMM20] - Western blot analysis of lysates from 293T cells using TOMM20 Rabbit mAb at 1:5000 dilution incubated overnight at 4C.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 10s.

Immunohistochemistry: TOMM20 Antibody (10G6I8) [TOMM20] - Immunohistochemistry analysis of paraffin-embedded Rat intestine tissue using TOMM20 Rabbit mAb at a dilution of 1:5000 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF, IHC, IP
• Clone: 10G6I8
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TOMM20 Antibody (10G6I8) Summary

• Description: Novus Biologicals Rabbit TOMM20 Antibody (10G6I8) (NBP3-15750) is a recombinant monoclonal antibody validated for use in IHC, WB, ELISA, ICC/IF and IP. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 20-145 of human TOMM20 (NP_055580.1). YCIYFDRKRRSDPNFKNRLRERRKKQKLAKERAGLSKLPDLKDAEAVQKFFLEEIQLGEELLAQGEYEKGVDHLTNAIAVCGQPQQLLQVLQQTLPPPVFQMLLTKLPTISQRIVSAQSLAEDDVE
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TOMM20
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:100 - 1:500
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Immunoprecipitation -0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
  • Western Blot 1:2000 - 1:6000
• Theoretical MW: 16 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for TOMM20 Antibody (10G6I8)

• KIAA0016Outer mitochondrial membrane receptor Tom20
• MAS20
• MGC117367
• mitochondrial 20 kDa outer membrane protein
• mitochondrial import receptor subunit TOM20 homolo
• mitochondrial import receptor subunit TOM20 homolog
• MOM19
• outer mitochondrial membrane receptor Tom20
• TOM20
• TOMM20
• translocase of outer mitochondrial membrane 20 hom
• translocase of outer mitochondrial membrane 20 homolog (yeast)
• translocase of outer mitochondrial membrane 20 homolog type II

Background

Central component of the receptor complex responsible for the recognition and translocation of cytosolically synthesized mitochondrial preproteins. Together with TOM22 functions as the transit peptide receptor at the surface of the mitochondrion outer membrane and facilitates the movement of preproteins into the TOM40 translocation pore

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOMM20