TOE1 Antibody

Images

 
Western Blot: TOE1 Antibody [NBP2-49587] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4
Immunocytochemistry/ Immunofluorescence: TOE1 Antibody [NBP2-49587] - Staining of human cell line CACO-2 shows localization to nuclear bodies.
Orthogonal Strategies: Immunohistochemistry-Paraffin: TOE1 Antibody [NBP2-49587] - Staining in human testis and liver tissues using anti-TOE1 antibody. Corresponding TOE1 RNA-seq data are presented for the same ...read more
Immunohistochemistry: TOE1 Antibody [NBP2-49587] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: TOE1 Antibody [NBP2-49587] - Staining of human liver shows low expression as expected.
Immunohistochemistry-Paraffin: TOE1 Antibody [NBP2-49587] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

TOE1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LHRAGFDAFMTGYVMAYVEVSQGPQPCSSGPWLPECHNKVYLSGKAVPLTVAKSQFSRSSKAHNQKMKLTWGS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOE1 Recombinant Protein Antigen (NBP2-49587PEP)

Reactivity Notes

Mouse (88%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TOE1 Antibody

  • FLJ13949
  • target of EGR1 protein 1
  • target of EGR1, member 1 (nuclear)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001958-M03
Species: Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
7754-BH/CF
Species: Hu
Applications: BA
H00001181-M01
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
AF1443
Species: Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP1-82558
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00010420-M04
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-46090
Species: Hu
Applications: IHC, WB
NBP2-45884
Species: Hu
Applications: Flow, IF, IHC, WB
AF2046
Species: Hu, Mu
Applications: ICC, IHC, Simple Western, WB
NB300-190
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-84307
Species: Hu
Applications: ICC/IF, WB
NBP2-46085
Species: Hu
Applications: IHC, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-49587
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TOE1 Antibody (NBP2-49587) (0)

There are no publications for TOE1 Antibody (NBP2-49587).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOE1 Antibody (NBP2-49587) (0)

There are no reviews for TOE1 Antibody (NBP2-49587). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TOE1 Antibody (NBP2-49587) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOE1 Products

Bioinformatics Tool for TOE1 Antibody (NBP2-49587)

Discover related pathways, diseases and genes to TOE1 Antibody (NBP2-49587). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOE1 Antibody (NBP2-49587)

Discover more about diseases related to TOE1 Antibody (NBP2-49587).
 

Pathways for TOE1 Antibody (NBP2-49587)

View related products by pathway.

Blogs on TOE1

There are no specific blogs for TOE1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOE1