TESK2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: TESK2 Antibody [NBP1-89442] Staining of human cell line A-431 shows positivity in nucleus but not nucleoli.
Immunohistochemistry-Paraffin: TESK2 Antibody [NBP1-89442] - Staining of human testis shows moderate positivity in subsets of cells in sminiferus ducts.
Immunocytochemistry/ Immunofluorescence: TESK2 Antibody [NBP1-89442] - Immunofluorescent staining of human cell line A-431 shows positivity in nucleus but not nucleoli.

Product Details

Summary
Reactivity Hu, RatSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

TESK2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDKIPHKSPCPRRTIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVNPFSARQDLMGGKIKFFDLPSKSVISLVF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TESK2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin HIER pH6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Control Peptide
TESK2 Protein (NBP1-89442PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (88%)

Alternate Names for TESK2 Antibody

  • dual specificity testis-specific protein kinase 2
  • EC 2.7.12.1
  • Testicular protein kinase 2
  • testis-specific kinase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-51361
Species: Hu, Mu, Rt
Applications: WB
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00081629-D01P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
H00003984-M01A
Species: Hu, Mu, Rt
Applications: WB, ELISA
H00083942-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NBP2-45646
Species: Hu, Ca
Applications: WB, IHC
NBP2-47476
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, InhibTFunc
NBP2-13752
Species: Hu
Applications: IHC, IHC-P
NBP1-90802
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48967
Species: Hu
Applications: IHC
NBP2-22522
Species: Mu, Rt, Xp
Applications: WB
NBP2-45862
Species: Hu
Applications: WB, IHC
H00023617-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC
NB100-40830
Species: Hu
Applications: WB, IP
NBP1-89442
Species: Hu, Rat
Applications: ICC/IF, IHC, IHC-P

Publications for TESK2 Antibody (NBP1-89442) (0)

There are no publications for TESK2 Antibody (NBP1-89442).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TESK2 Antibody (NBP1-89442) (0)

There are no reviews for TESK2 Antibody (NBP1-89442). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TESK2 Antibody (NBP1-89442) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TESK2 Antibody Products

Related Products by Gene

Bioinformatics Tool for TESK2 Antibody (NBP1-89442)

Discover related pathways, diseases and genes to TESK2 Antibody (NBP1-89442). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TESK2 Antibody (NBP1-89442)

Discover more about diseases related to TESK2 Antibody (NBP1-89442).
 

Pathways for TESK2 Antibody (NBP1-89442)

View related products by pathway.

PTMs for TESK2 Antibody (NBP1-89442)

Learn more about PTMs related to TESK2 Antibody (NBP1-89442).
 

Research Areas for TESK2 Antibody (NBP1-89442)

Find related products by research area.

Blogs on TESK2

There are no specific blogs for TESK2, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol TESK2

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP1-89442 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought