TOE1 Antibody - BSA Free

Western Blot: TOE1 Antibody [NBP1-53158] - Human Brain lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TOE1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TOE1(target of EGR1, member 1 (nuclear)) The peptide sequence was selected from the N terminal of TOE1. Peptide sequence VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TOE1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TOE1 Antibody - BSA Free

• FLJ13949
• target of EGR1 protein 1
• target of EGR1, member 1 (nuclear)

Background

TOE1 belongs to the CAF1 family and 1 C3H1-type zinc finger. TOE1 inhibits cell growth rate and cell cycle. It induces CDKN1A expression as well as TGF-beta expression and mediates the inhibitory growth effect of EGR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOE1
• Uniprot:
  • Q96GM8(Human)