TOE1 Antibody

Images

 
Western Blot: TOE1 Antibody [NBP1-53158] - Human Brain lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TOE1 Antibody Summary

Immunogen
Synthetic peptides corresponding to TOE1(target of EGR1, member 1 (nuclear)) The peptide sequence was selected from the N terminal of TOE1. Peptide sequence VVDVQSNNFKEMWPSLLLAIKTANFVAVDTELSGLGDRKSLLNQCIEERY.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TOE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against TOE1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TOE1 Antibody

  • FLJ13949
  • target of EGR1 protein 1
  • target of EGR1, member 1 (nuclear)

Background

TOE1 belongs to the CAF1 family and 1 C3H1-type zinc finger. TOE1 inhibits cell growth rate and cell cycle. It induces CDKN1A expression as well as TGF-beta expression and mediates the inhibitory growth effect of EGR1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NB600-1032
Species: Hu, Mu, Rt, Ba
Applications: WB, ICC/IF, IHC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85585
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010420-M04
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46090
Species: Hu
Applications: WB, IHC
NBP2-45884
Species: Hu
Applications: WB, Flow, IHC, IF
AF2046
Species: Hu
Applications: WB, Simple Western, ICC
NB300-190
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-53158
Species: Hu
Applications: WB

Publications for TOE1 Antibody (NBP1-53158) (0)

There are no publications for TOE1 Antibody (NBP1-53158).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOE1 Antibody (NBP1-53158) (0)

There are no reviews for TOE1 Antibody (NBP1-53158). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TOE1 Antibody (NBP1-53158) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TOE1 Products

Bioinformatics Tool for TOE1 Antibody (NBP1-53158)

Discover related pathways, diseases and genes to TOE1 Antibody (NBP1-53158). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOE1 Antibody (NBP1-53158)

Discover more about diseases related to TOE1 Antibody (NBP1-53158).
 

Pathways for TOE1 Antibody (NBP1-53158)

View related products by pathway.

Blogs on TOE1

There are no specific blogs for TOE1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TOE1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TOE1
Uniprot