TOB1 Antibody


Immunocytochemistry/ Immunofluorescence: TOB1 Antibody [NBP2-55845] - Staining of human cell line MCF7 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: TOB1 Antibody [NBP2-55845] - Immunohistochemical staining of human adrenal gland shows nuclear positivity in glandular cells.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

TOB1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: STKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQ
Specificity of human TOB1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (91%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TOB1 Recombinant Protein Antigen (NBP2-55845PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for TOB1 Antibody

  • APRO6
  • MGC104792
  • PIG49
  • protein Tob1
  • TOB1
  • TOBMGC34446
  • Transducer of erbB-2 1
  • transducer of ERBB2, 1
  • TROB
  • TROB1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Bv, Ca, Ch, Eq, Pm
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IP
Species: Hu
Applications: WB, ICC/IF, IP, KD
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC, KO
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Bv, Ca, Pm, Xp, Dr(-), Mu(-)
Applications: WB, ELISA, Flow, ICC/IF, IP, MiAr, CyTOF-ready
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P

Publications for TOB1 Antibody (NBP2-55845) (0)

There are no publications for TOB1 Antibody (NBP2-55845).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TOB1 Antibody (NBP2-55845) (0)

There are no reviews for TOB1 Antibody (NBP2-55845). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for TOB1 Antibody (NBP2-55845) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional TOB1 Products

Bioinformatics Tool for TOB1 Antibody (NBP2-55845)

Discover related pathways, diseases and genes to TOB1 Antibody (NBP2-55845). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TOB1 Antibody (NBP2-55845)

Discover more about diseases related to TOB1 Antibody (NBP2-55845).

Pathways for TOB1 Antibody (NBP2-55845)

View related products by pathway.

PTMs for TOB1 Antibody (NBP2-55845)

Learn more about PTMs related to TOB1 Antibody (NBP2-55845).

Research Areas for TOB1 Antibody (NBP2-55845)

Find related products by research area.

Blogs on TOB1

There are no specific blogs for TOB1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TOB1 Antibody and receive a gift card or discount.


Gene Symbol TOB1