TOB1 Antibody - Azide and BSA Free

Western Blot: TOB1 Antibody [H00010140-B01P] - Analysis of TOB1 expression in transfected 293T cell line by TOB1 polyclonal antibody. Lane 1: TOB1 transfected lysate(37.95 KDa). Lane 2: Non-transfected lysate.

Immunocytochemistry/Immunofluorescence: TOB1 Antibody [H00010140-B01P] - Analysis of purified antibody to TOB1 on HeLa cell. (antibody concentration 10 ug/ml)

Immunohistochemistry-Paraffin: TOB1 Antibody [H00010140-B01P] - Analysis of purified antibody to TOB1 on formalin-fixed paraffin-embedded human endometrium. (antibody concentration 3 ug/ml)

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TOB1 Antibody - Azide and BSA Free Summary

• Immunogen: TOB1 (NP_005740.1, 1 a.a. - 345 a.a.) full-length human protein. MQLEIQVALNFIISYLYNKLPRRRVNIFGEELERLLKKKYEGHWYPEKPYKGSGFRCIHIGEKVDPVIEQASKESGLDIDDVRGNLPQDLSVWIDPFEVSYQIGEKGPVKVLYVDDNNENGCELDKEIKNSFNPEAQVFMPISDPASSVSSSPSPPFGHSAAVSPTFMPRSTQPLTFTTATFAATKFGSTKMKNSGRSNKVARTSPINLGLNVNDLLKQKAISSSMHSLYGLGLGSQQQPQQQQQPAQPPPPPPPPQQQQQQKTSALSPNAKEFIFPNMQGQGSSTNGMFPGDSPLNLSPLQYSNAFDVFAAYGGLNEKSFVDGLNFSLNNMQYSNQQFQPVMAN
• Specificity: TOB1 - transducer of ERBB2, 1,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: TOB1
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control. May also be used for immunofluorescence, immunohistochemistry (paraffin).

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TOB1 Antibody - Azide and BSA Free

• APRO6
• MGC104792
• PIG49
• protein Tob1
• TOB1
• TOBMGC34446
• Transducer of erbB-2 1
• transducer of ERBB2, 1
• TROB
• TROB1

Background

This gene encodes a member of the tob/btg1 family of anti-proliferative proteins that have the potential to regulate cell growth. When exogenously expressed, this protein supresses cell growth in tissue culture. The protein undergoes phophorylation by a serine/threonine kinase, 90 kDa ribosomal S6 kinase. Interactions of this protein with the v-erb-b2 erythroblastic leukemia viral oncogene homolog 2 gene product p185 interferes with growth suppression. This protein inhibits T cell proliferation and transcription of cytokines and cyclins. The protein interacts with both mothers against decapentaplegic Drosophila homolog 2 and 4 to enhance their DNA binding activity. This interaction inhibits interleukin 2 transcription in T cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TOB1
• Entrez:
  • 10140(Human)
• Uniprot:
  • NP_005740.1(Human)