TNS3 Antibody - BSA Free

Western Blot: TNS3 Antibody [NBP2-85969] - Host: Rabbit. Target Name: Tns3. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TNS3 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of MOUSE TNS3. Peptide sequence: FLTVSPGASSHHSPGLQNQNVSLPGQPPLPEKKRASEGDRSLGSVSPSSS The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TNS3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TNS3 Antibody - BSA Free

• TEM6
• TENS1
• Tensin 3
• tensin-3
• Tensin-Like SH2 Domain Containing 1
• Tensin-Like SH2 Domain-Containing 1
• Tensin-Like SH2 Domain-Containing Protein 1
• Thyroid Specific PTB Domain Protein
• TPP
• Tumor Endothelial Marker 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TNS3