Tripeptidyl-Peptidase I/TPP1 Antibody


Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human kidney.
Immunohistochemistry: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human heart muscle shows strong granular cytoplasmic positivity in myocytes.
Immunohistochemistry: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human adrenal gland shows high expression.
Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human skeletal muscle shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining in human adrenal gland and skeletal muscle tissues using anti-TPP1 antibody. Corresponding TPP1 more
Independent Antibodies: Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human adrenal gland, kidney, skeletal muscle and testis using Anti-TPP1 antibody NBP2-48820 more
Immunohistochemistry-Paraffin: Tripeptidyl-Peptidase I/TPP1 Antibody [NBP2-48820] - Staining of human testis.

Product Details

Reactivity HuSpecies Glossary
Applications IHC, IHC-P

Order Details

Tripeptidyl-Peptidase I/TPP1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: SSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Tripeptidyl-Peptidase I/TPP1 Recombinant Protein Antigen (NBP2-48820PEP)

Reactivity Notes

Mouse (82%), Rat (83%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for Tripeptidyl-Peptidase I/TPP1 Antibody

  • Cell growth-inhibiting gene 1 protein
  • ceroid-lipofuscinosis, neuronal 2, late infantile (Jansky-Bielschowsky disease)
  • CLN2
  • CLN2EC
  • growth-inhibiting protein 1
  • LPIC
  • lysosomal pepstatin insensitive protease
  • Lysosomal pepstatin-insensitive protease
  • MGC21297
  • TPP1
  • TPP-1
  • TPP-I
  • Tripeptidyl aminopeptidase
  • tripeptidyl peptidase I
  • tripeptidyl-peptidase 1
  • TripeptidylPeptidase I
  • Tripeptidyl-Peptidase I


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Pl
Applications: WB, Simple Western, ChIP, EM, ICC/IF, IHC, IHC-Fr, IHC-P, IM, IHC-WhMt, KD
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ma, Mar
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Mar, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, ICC/IF
Species: Mu
Applications: WB, IHC, IP, ICC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: IHC, IHC-P

Publications for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820) (0)

There are no publications for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820) (0)

There are no reviews for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Tripeptidyl-Peptidase I/TPP1 Products

Bioinformatics Tool for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820)

Discover related pathways, diseases and genes to Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820)

Discover more about diseases related to Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820).

Pathways for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820)

View related products by pathway.

PTMs for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820)

Learn more about PTMs related to Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820).

Research Areas for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820)

Find related products by research area.

Blogs on Tripeptidyl-Peptidase I/TPP1

There are no specific blogs for Tripeptidyl-Peptidase I/TPP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Tripeptidyl-Peptidase I/TPP1 Antibody and receive a gift card or discount.


Gene Symbol TPP1