Tripeptidyl-Peptidase I/TPP1 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit Tripeptidyl-Peptidase I/TPP1 Antibody - BSA Free (NBP2-48820) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: SSLRQRPEPQVTGTVGLHLGVTPSVIRKRYNLTSQDVGSGTSNNSQACAQFLEQYFHDSDLAQFMRLFGGNFAHQASVARVV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TPP1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Control Peptide |
|
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for Tripeptidyl-Peptidase I/TPP1 Antibody - BSA Free
Background
TPP1 encodes a member of the sedolisin family of serine proteases. The protease functions in the lysosome to cleave N-terminal tripeptides from substrates, and has weaker endopeptidase activity. It is synthesized as a catalytically-inactive enzyme which is activated and auto-proteolyzed upon acidification. Mutations in this gene result in late-infantile neuronal ceroid lipofuscinosis, which is associated with the failure to degrade specific neuropeptides and a subunit of ATP synthase in the lysosome.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Pl, Rt
Applications: ChIP, ChIP, EM, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IM, KD, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: ChHa, Hu, Mu, Pm, Rt
Applications: ChIP, DB, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, WB
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: ICC/IF, WB
Species: Mu
Applications: ICC, IHC, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Publications for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820) (0)
There are no publications for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820) (0)
There are no reviews for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Tripeptidyl-Peptidase I/TPP1 Products
Research Areas for Tripeptidyl-Peptidase I/TPP1 Antibody (NBP2-48820)
Find related products by research area.
|
Blogs on Tripeptidyl-Peptidase I/TPP1