TNNC2 Antibody

Images

 
Immunohistochemistry-Paraffin: TNNC2 Antibody [NBP1-86205] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNNC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:NADGYIDPEELAEIFRASGEHVTDEEIESLM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNNC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNNC2 Protein (NBP1-86205PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNNC2 Antibody

  • skeletal muscle
  • troponin C type 2 (fast)
  • troponin C2, fast

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32770
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37536
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, CyTOF-ready
NB100-1908
Species: Hu, Mu, Rt, Po, Bv, Ch, Rb
Applications: WB, ELISA, ICC/IF, IHC, IP, MiAr
NB100-74340
Species: Hu, Mu, Rt, Bv, ChHa, Dr, Fu, Pl, Pr, Rb, Sh, Xp, Ye, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-26199
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, PEP-ELISA
NB300-622
Species: Hu, Mu, Rt, Am, Ca, Rb
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP2-58195
Species: Hu
Applications: ICC/IF
NBP2-37364
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-49036
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-89707
Species: Hu
Applications: IHC, IHC-P
AF4509
Species: Hu
Applications: WB, ICC
NBP2-52559
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-45808
Species: Hu
Applications: IHC
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for TNNC2 Antibody (NBP1-86205) (0)

There are no publications for TNNC2 Antibody (NBP1-86205).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNNC2 Antibody (NBP1-86205) (0)

There are no reviews for TNNC2 Antibody (NBP1-86205). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for TNNC2 Antibody (NBP1-86205) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNNC2 Products

Bioinformatics Tool for TNNC2 Antibody (NBP1-86205)

Discover related pathways, diseases and genes to TNNC2 Antibody (NBP1-86205). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNNC2 Antibody (NBP1-86205)

Discover more about diseases related to TNNC2 Antibody (NBP1-86205).
 

Pathways for TNNC2 Antibody (NBP1-86205)

View related products by pathway.

Blogs on TNNC2

There are no specific blogs for TNNC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNNC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNNC2