TNFAIP1 Antibody

Images

 
Western Blot: TNFAIP1 Antibody [NBP1-88931] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: TNFAIP1 Antibody [NBP1-88931] - Staining of human smooth muscle shows weak cytoplasmic positivity in smooth muscle cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TNFAIP1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EARIYEETLNVLLYETPRVPDNSLLEATSRSRSQASPSEDEETFELRDRVRRIHVKRYSTYDDRQLGHQSTHRD
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TNFAIP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TNFAIP1 Protein (NBP1-88931PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TNFAIP1 Antibody

  • B12
  • B61
  • BACURD2
  • BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 2
  • BTB/POZ domain-containing protein TNFAIP1
  • EDP1
  • hBACURD2
  • MGC2317
  • Protein B12
  • tumor necrosis factor, alpha-induced protein 1 (endothelial)
  • Tumor necrosis factor, alpha-induced protein 1, endothelial

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBL1-11228
Species: Hu
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-03417
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-83552
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
H00003703-M02
Species: Hu
Applications: WB, ELISA, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for TNFAIP1 Antibody (NBP1-88931) (0)

There are no publications for TNFAIP1 Antibody (NBP1-88931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TNFAIP1 Antibody (NBP1-88931) (0)

There are no reviews for TNFAIP1 Antibody (NBP1-88931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TNFAIP1 Antibody (NBP1-88931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TNFAIP1 Products

Bioinformatics Tool for TNFAIP1 Antibody (NBP1-88931)

Discover related pathways, diseases and genes to TNFAIP1 Antibody (NBP1-88931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TNFAIP1 Antibody (NBP1-88931)

Discover more about diseases related to TNFAIP1 Antibody (NBP1-88931).
 

Pathways for TNFAIP1 Antibody (NBP1-88931)

View related products by pathway.

PTMs for TNFAIP1 Antibody (NBP1-88931)

Learn more about PTMs related to TNFAIP1 Antibody (NBP1-88931).
 

Research Areas for TNFAIP1 Antibody (NBP1-88931)

Find related products by research area.

Blogs on TNFAIP1

There are no specific blogs for TNFAIP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TNFAIP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFAIP1