![Immunohistochemistry-Paraffin: TMX4 Antibody [NBP1-85159] - Staining in human testis and pancreas tissues using anti-TMX4 antibody. Corresponding TMX4 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/TMX4-Antibody-Immunohistochemistry-Paraffin-NBP1-85159-img0007.jpg "Immunohistochemistry-Paraffin: TMX4 Antibody [NBP1-85159] - Staining in human testis and pancreas tissues using anti-TMX4 antibody. Corresponding TMX4 RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit TMX4 Antibody - BSA Free (NBP1-85159) is a polyclonal antibody validated for use in IHC and WB. Anti-TMX4 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: QLTALLAAWIAAVAATAGPEEAALPPEQSRVQPMTASNWTLVMEGEWMLKFYAPWCPSCQQTDSEWEAFAKNGEILQISVGKVDVIQEPGLSGRFFVTTLPAFFHAKDGIF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TMX4 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TMX4 |
![Western Blot: TMX4 Antibody [NBP1-85159] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/TMX4-Antibody-Western-Blot-NBP1-85159-img0003.jpg "Western Blot: TMX4 Antibody [NBP1-85159] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11 Lane 2: Human cell line RT-4 Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: TMX4 Antibody [NBP1-85159] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and nuclear membranous staining in Leydig cells.](http://images.novusbio.com/fullsize/TMX4-Antibody-Immunohistochemistry-Paraffin-NBP1-85159-img0002.jpg "Immunohistochemistry-Paraffin: TMX4 Antibody [NBP1-85159] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts and nuclear membranous staining in Leydig cells.")
![Immunohistochemistry-Paraffin: TMX4 Antibody [NBP1-85159] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/TMX4-Antibody-Immunohistochemistry-Paraffin-NBP1-85159-img0004.jpg "Immunohistochemistry-Paraffin: TMX4 Antibody [NBP1-85159] - Staining of human pancreas shows low expression as expected.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")