TMEM9B Antibody

Images

 
Western Blot: TMEM9B Antibody [NBP1-88545] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-586
Immunohistochemistry-Paraffin: TMEM9B Antibody [NBP1-88545] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM9B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EPILKRRLFGHAQLIQSDDDIGDHQPFANAHDVLARSRSRANVLNKVEYAQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TMEM9B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
TMEM9B Protein (NBP1-88545PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TMEM9B Antibody

  • C11orf15
  • chromosome 11 open reading frame 15
  • TMEM9 domain family, member B
  • transmembrane protein 9B

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-69589
Species: Hu
Applications: WB
NBP1-77077
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-02293
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32367
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-46228
Species: Hu
Applications: WB, IHC
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)
NB100-56363
Species: Hu, Mu
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-14336
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-90310
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-57788
Species: Hu
Applications: ICC/IF
AF3850
Species: Hu
Applications: WB
NBP1-83541
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88545
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for TMEM9B Antibody (NBP1-88545) (0)

There are no publications for TMEM9B Antibody (NBP1-88545).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TMEM9B Antibody (NBP1-88545) (0)

There are no reviews for TMEM9B Antibody (NBP1-88545). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM9B Antibody (NBP1-88545) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TMEM9B Products

Bioinformatics Tool for TMEM9B Antibody (NBP1-88545)

Discover related pathways, diseases and genes to TMEM9B Antibody (NBP1-88545). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM9B Antibody (NBP1-88545)

Discover more about diseases related to TMEM9B Antibody (NBP1-88545).
 

Pathways for TMEM9B Antibody (NBP1-88545)

View related products by pathway.

PTMs for TMEM9B Antibody (NBP1-88545)

Learn more about PTMs related to TMEM9B Antibody (NBP1-88545).
 

Research Areas for TMEM9B Antibody (NBP1-88545)

Find related products by research area.

Blogs on TMEM9B

There are no specific blogs for TMEM9B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM9B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TMEM9B