TMEM48 Antibody

Images

 
Western Blot: TMEM48 Antibody [NBP1-91604] - Host: Rabbit. Target: NDC1. Positive control (+): HeLa Cell Lysate (HL). Negative control (-): MCF7 Cell Lysate (N10). Antibody concentration: 1ug/ml
Western Blot: TMEM48 Antibody [NBP1-91604] - Human Lung lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity Hu, Mu, Rt, Bv, Ca, Eq, Gp, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TMEM48 Antibody Summary

Immunogen
Synthetic peptide directed towards the middle region of human TMEM48. Peptide sequence PPIIKYLALQDLMLLSQYSPSRRQEVFSLSQPGGHPHNWTAISRECLNLL. The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Mouse (100%), Rat (100%), Canine (100%), Equine (100%), Zebrafish (100%), Guinea Pig (100%), Bovine (100%), Rabbit (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
NDC1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000
Application Notes
This is a rabbit polyclonal antibody against TMEM48 and was validated on Western blot.
Control
TMEM48 Knockout HeLa Cell Lysate
Publications
Read Publication using NBP1-91604.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TMEM48 Antibody

  • FLJ10407
  • FLJ34120
  • NDC1
  • NET3
  • transmembrane protein 48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: Hu, Mu, Rt, Po, ChHa, Ha, Pm
Applications: WB, EM, ICC/IF, IHC, IHC-P, IP, KD, KO
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
H00022932-M02
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP2-93742
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-83213
Species: Hu
Applications: WB, IHC, IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-93322
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-81546
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003930-B01P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76926
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
AF2449
Species: Hu
Applications: WB, IP
NBP1-91247
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-45402
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC
NBP2-59783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92205
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
AF3014
Species: Hu
Applications: WB, IHC, Block
NBP2-02211
Species: Hu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for TMEM48 Antibody (NBP1-91604)(1)

Reviews for TMEM48 Antibody (NBP1-91604) (0)

There are no reviews for TMEM48 Antibody (NBP1-91604). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TMEM48 Antibody (NBP1-91604) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TMEM48 Products

Bioinformatics Tool for TMEM48 Antibody (NBP1-91604)

Discover related pathways, diseases and genes to TMEM48 Antibody (NBP1-91604). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TMEM48 Antibody (NBP1-91604)

Discover more about diseases related to TMEM48 Antibody (NBP1-91604).
 

Pathways for TMEM48 Antibody (NBP1-91604)

View related products by pathway.

Blogs on TMEM48

There are no specific blogs for TMEM48, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TMEM48 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol NDC1
Uniprot